[beta]-Amyloid (11- 40)

Buy 5, pay 4 If you order 5 or more of the same off-the-shelf peptide product at once, you will receive one of them for free.
€277.75 *

Prices plus VAT plus shipping costs

Delivery time 2-3 days
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.

Amount in mg:

5 mg

  • EP10013_5
Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42)... more
Product information "[beta]-Amyloid (11- 40)"

Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.

Available downloads:

 
Sequence:EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Gene:APP
Delivery:2-3 days
C-Terminus:OH
N-Terminus:H
Purity:95%
Amount:1 mg
Counter Ion:TFA
Protein:Amyloid-beta precursor protein
Species:Human
Application :Neuroscience
Indication :Alzheimer's Disease
####
    Viewed
    [beta]-Amyloid (11- 40)