[beta]-Amyloid (1-39)

Buy 5, pay 4 If you order 5 or more of the same off-the-shelf peptide product at once, you will receive one of them for free.
€362.25 *

Prices plus VAT plus shipping costs

Delivery time 3 weeks
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.

Amount in mg:

5 mg

  • EP10043_1
A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and... more
Product information "[beta]-Amyloid (1-39)"

A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and 1-43), are identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease. The length of the C-terminus is a critical determinant of the rate of amyloid formation (“kinetic solubility”), with only a minor effect on the thermodynamic solubility. Amyloid formation by the kinetically soluble peptides (e.g. 1-39) can be nucleated, or “seeded” by peptides which include the critical C-terminal residues (1-42, 26-42, 26-43, 34-42).

Available downloads:

 
Sequence:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Gene:APP
Delivery: 3 weeks
C-Terminus:OH
N-Terminus:H
Purity:95%
Amount:1 mg
Counter Ion:TFA
Protein:Amyloid-beta precursor protein
Species:Human
Application :Neuroscience
Indication :Alzheimer's Disease
####
    Viewed
    [beta]-Amyloid (1-39)