LL - 37
The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). Antimicrobial peptide LL-37,ï¾ belongsï¾ to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human.ï¾ It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds.ï¾ Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution.
| Sequence: | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | |
| Delivery: | 3 weeks | |
| C-Terminus: | OH | |
| N-Terminus: | H | |
| Amount: | 1 mg | |
| Counter Ion: | TFA | |
| Allele: | ||
| Purity : | 95% HPLC-MS |
Protocols and Tips
Data sheets
Safety data sheet poly peptides:
Special references for this product will come soon.
For your convenience, we have compiled a selection of publications
where our peptide products have been employed:
Publications >
For your convenience, we have compiled a selection of publications
where our peptide products have been employed:
Publications >
€211.35*
Delivery time 2-3 days
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.
Purity: 95% HPLC-MS
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.
Purity: 95% HPLC-MS
Product number:
EP11651_1