LL - 37 | Single Peptides | Peptide-Shop

Buy 5, pay 4 If you order 5 or more of the same off-the-shelf peptide product at once, you will receive one of them for free.

€211.35 *

Prices plus VAT plus shipping costs

Delivery time 3 weeks
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.

Order number: EP11651_1

The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic... more

Close menu

Product information "LL - 37"

The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). Antimicrobial peptide LL-37,ï¾ belongsï¾ to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human.ï¾ It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds.ï¾ Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution.

Available downloads:

Download Safety Data Sheet

Zurück

Sequence:	[LL-37, 37 aa]
Delivery:	3 weeks
C-Terminus:	OH
N-Terminus:	H
Purity:	95%
Amount:	1 mg
Counter Ion:	TFA
Synonyme :	other name: Baculoviral IAP repeat-containing protein 7 (280-289); ML-IAP 280-289