LL - 37
Prices plus VAT plus shipping costs
Delivery time 3 weeks
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.
- Order number: EP11651_1
The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). Antimicrobial peptide LL-37,ï¾ belongsï¾ to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human.ï¾ It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds.ï¾ Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution.
Sequence: | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | |
Delivery: | 3 weeks | |
C-Terminus: | OH | |
N-Terminus: | H | |
Purity: | 95% | |
Amount: | 1 mg | |
Counter Ion: | TFA | |
Synonyme : | other name: Baculoviral IAP repeat-containing protein 7 (280-289); ML-IAP 280-289 |
Protocols and Tips
Data sheets