LL - 37, scrambled

LL - 37, scrambled
€201.25 *

Prices plus VAT plus shipping costs

Delivery time 3 weeks
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.

Amount in mg:

5 mg

  • Order number: EP11652_1
Description Technical data Documents Accessories
Description
Anti-microbial Peptide Human Host Defense Peptide more
Close menu
Product information "LL - 37, scrambled"

Anti-microbial Peptide Human Host Defense Peptide

Available downloads:
more

Zurück
 
Sequence:GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Delivery: 3 weeks
C-Terminus:OH
N-Terminus:H
Purity:95%
Amount:1 mg
Counter Ion:TFA
####
    Dokumente - Protokolle - Downloads more
    Zurück

    Protocols and Tips

    Data sheets

     
    Accessories 0
    Customers also bought Customers also viewed
    Customers also bought
    Customers also viewed
    RSV Fusion protein 82-90 (HLA-A*02:01)
    From €57.50 *
    Tyrosinase 146-156 (HLA-A*01:01)
    From €57.50 *
    MAGE-A4 230–239 (HLA-A*02:01)
    From €57.50 *
    [beta]-Amyloid (1-39)
    From €345.00 *
    HCMV IE-1 316-324 (HLA-A*02:01)
    From €57.50 *
    Hint!
    HUMAN (Actin) Peptide Pool HUMAN (Actin) Peptide Pool
    €172.50 *
    VZV (IE63) Peptide Pool VZV (IE63) Peptide Pool
    €172.50 *
    EBV (LMP2) Peptide Pool EBV (LMP2) Peptide Pool
    €247.25 *
    EBV (EBNA-3b) Peptide Pool EBV (EBNA-3b) Peptide Pool
    €218.50 *
    HPV16 E7 Peptide Pool HPV16 E7 Peptide Pool
    €172.50 *
    EBV LMP-2 340-349 mutant (HLA-A*11:01) 348T
    From €57.50 *
    HPV E6 133–142
    From €57.50 *
    RSV Fusion protein 191-199 (HLA-A*02:01)
    From €57.50 *
    Serine protease hepsin (229-237)
    From €57.50 *
    Plasmodium falciparum CSP 334-342 (HLA-A*02:01)
    From €57.50 *
    MAGEA-10 254-262 (HLA-A*02:01)
    From €57.50 *
    Insulin 15-24 (HLA-A*02:01)
    From €57.50 *
    Influenza A NP 44-52 (HLA-A*01:01)
    From €57.50 *
    Influenza A PB1 329-337 (HLA-B*07:02)
    From €57.50 *
    HIV-1 env gp120 843–851 (HLA-B*07:02)
    From €57.50 *
    EBV BZLF1 44-52 (HLA-B*07:02)
    From €57.50 *
    FAP alpha 463-471 (HLA-A*02:01)
    From €57.50 *
    EBV EBNA-3C 881-889 (HLA-B*07:02)
    From €57.50 *
    [beta]-Amyloid (1-40)
    From €345.00 *
    HIV-1 RT 476-484 (HLA-A*02:01)
    From €57.50 *
    HM1.24 126-134 (HLA-A*02:01)
    From €57.50 *
    NY-ESO-1 157-165 (HLA-A*02:01)
    From €57.50 *
    EBV EBNA-3A 325-333 (HLA-B*08:01)
    From €57.50 *
    Tyrosinase 369-377 mutant (HLA-A*02:01) 371D
    From €57.50 *
    OVA-Peptid (323-339) (H-2Kb)
    From €92.00 *
    OVA - T4 , SIITFEKL, pT4, OVA (257 - 264)...
    From €57.50 *
    OVA - Y3, SIYNFEKL (H-2Kb)
    From €57.50 *
    VZV (gE) Peptide Pool VZV (gE) Peptide Pool
    €195.50 *
    SARS-CoV-2 (NS6) Peptide Pool SARS-CoV-2 (NS6) Peptide Pool
    €172.50 *
    SARS-CoV-2 (N-Protein) Peptide Pool SARS-CoV-2 (N-Protein) Peptide Pool
    €230.00 *
    HIV SUB Peptide Pool (95% HPLC) HIV SUB Peptide Pool (95% HPLC)
    €172.50 *
    EBV EBNA-1 Peptide Pool EBV EBNA-1 Peptide Pool
    €218.50 *
    EBV (BZLF1) Peptide Pool EBV (BZLF1) Peptide Pool
    €201.25 *
    HUMAN Tyrosinase-related protein2 Peptide Pool HUMAN Tyrosinase-related protein2 Peptide Pool
    €207.00 *
    Hint!
    HIV-1 B Gag Peptide Pool HIV-1 B Gag Peptide Pool
    €230.00 *
    Viewed
    This website uses cookies to ensure you get the best experience on our website.
    Accept
    LL - 37, scrambled