LL - 37, scrambled

€201.25 *

Prices plus VAT plus shipping costs

Delivery time 3 weeks
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.

Amount in mg:

5 mg

  • EP11652_1
Anti-microbial Peptide Human Host Defense Peptide more
Product information "LL - 37, scrambled"

Anti-microbial Peptide Human Host Defense Peptide

Available downloads:

 
Sequence:GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Delivery: 3 weeks
C-Terminus:OH
N-Terminus:H
Purity:95%
Amount:1 mg
Counter Ion:TFA
####
    HPV16 E6 HPV16 E6
    €172.50 *
    p53 (Y220C)
    From €57.50 *
    HPV18 (L1) HPV18 (L1)
    €291.00 *
    HEL 11-25
    From €115.00 *
    LCMV NP 201-215
    From €115.00 *
    STREP-tag II
    From €57.50 *
    NRP-A7 (H-2Kd)
    From €57.50 *
    Derp1 117–127
    From €92.00 *
    Viewed
    LL - 37, scrambled