LL - 37, scrambled

LL - 37, scrambled
€175.00 *

Prices plus VAT plus shipping costs

Delivery time 3 weeks
sterile and endotoxin free Delivery Format:
The product is supplied freeze dried as trifluoracetate salt

Amount in mg:

5 mg

  • EP11652_1
Anti-microbial Peptide Human Host Defense Peptide more
Product information "LL - 37, scrambled"
Anti-microbial Peptide Human Host Defense Peptide

 
Sequence:GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Delivery: 3 weeks
C-Terminus:OH
N-Terminus:H
Purity:95%
Amount:1 mg
Counter Ion:TFA
Viewed