LL - 37, scrambled | Single Peptides | Peptide-Shop

Buy 5, pay 4 If you order 5 or more of the same off-the-shelf peptide product at once, you will receive one of them for free.

€211.35 *

Delivery time 3 weeks
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.

Anti-microbial Peptide Human Host Defense Peptide more

Product information "LL - 37, scrambled"

Anti-microbial Peptide Human Host Defense Peptide

Available downloads:

Sequence:	GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Delivery:	3 weeks
C-Terminus:	OH
N-Terminus:	H
Purity:	95%
Amount:	1 mg
Counter Ion:	TFA

####

Dokumente - Protokolle - Downloads more

Protocols and Tips

Data sheets