ACTH (1-39) (human)
€517.50 *
Prices plus VAT plus shipping costs
Delivery time 2-3 days
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.
- Order number: EP10644_5
ACTH (1-39), human is a synthetic peptide corresponding to the first 39 amino acids of human... more
Product information "ACTH (1-39) (human)"
ACTH (1-39), human is a synthetic peptide corresponding to the first 39 amino acids of human ACTH/adrenocorticotropin which is the major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.
Available downloads:
####
Sequence: | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF | |
Delivery: | 2-3 days | |
C-Terminus: | OH | |
N-Terminus: | H | |
Purity: | 95% | |
Amount: | 5 mg | |
Counter Ion: | TFA | |
Species: | HUMAN |
Dokumente - Protokolle - Downloads more
Protocols and Tips
Data sheets
NEW
Viewed