ACTH (1-39) (human)

ACTH (1-39) (human)
€517.50 *

Prices plus VAT plus shipping costs

Delivery time 2-3 days
sterile and endotoxin free Delivery Format:
The product is supplied freeze dried as trifluoracetate salt

Amount in mg:

5 mg

  • EP10644_5
ACTH (1-39), human is a synthetic peptide corresponding to the first 39 amino acids of human... more
Product information "ACTH (1-39) (human)"

ACTH (1-39), human is a synthetic peptide corresponding to the first 39 amino acids of human ACTH/adrenocorticotropin which is the major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.


 
Sequence:SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Delivery:2-3 days
C-Terminus:OH
N-Terminus:H
Purity:95%
Amount:5 mg
Counter Ion:TFA
Species:HUMAN
ORF2 46-54 ORF2 46-54
From €92.00 *
ABL1 (HLA-A*02:01) ABL1 (HLA-A*02:01)
From €57.50 *
ABL1 (HLA-A*02:01) ABL1 (HLA-A*02:01)
From €57.50 *
PAP 299-307 PAP 299-307
From €57.50 *
HBV_Polymerase_171 HBV_Polymerase_171
From €57.50 *
HBVcore14, (HBA31) HBVcore14, (HBA31)
From €115.00 *
[beta]-Amyloid (1-28) [beta]-Amyloid (1-28)
From €172.50 *
MOG 101 - 108, rat MOG 101 - 108, rat
From €57.50 *
MOG 35-55 human MOG 35-55 human
From €115.00 *
MUC1 (HLA-A*02:01) MUC1 (HLA-A*02:01)
From €57.50 *
NEW
Proinsulin 90-104 Proinsulin 90-104
From €115.00 *
Viewed