ACTH (1-39) (human)

Buy 5, pay 4 If you order 5 or more of the same off-the-shelf peptide product at once, you will receive one of them for free.
€543.38 *

Prices plus VAT plus shipping costs

Delivery time 2-3 days
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.

Amount in mg:

5 mg

  • EP10644_5
ACTH (1-39), human is a synthetic peptide corresponding to the first 39 amino acids of human... more
Product information "ACTH (1-39) (human)"

ACTH (1-39), human is a synthetic peptide corresponding to the first 39 amino acids of human ACTH/adrenocorticotropin which is the major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.

Available downloads:

 
Sequence:SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Delivery:2-3 days
C-Terminus:OH
N-Terminus:H
Purity:95%
Amount:5 mg
Counter Ion:TFA
Species:HUMAN
####
    Viewed
    ACTH (1-39) (human)