ACTH (1-39) (human)

€517.50 *

Prices plus VAT plus shipping costs

Delivery time 2-3 days
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.

Amount in mg:

5 mg

  • EP10644_5
ACTH (1-39), human is a synthetic peptide corresponding to the first 39 amino acids of human... more
Product information "ACTH (1-39) (human)"

ACTH (1-39), human is a synthetic peptide corresponding to the first 39 amino acids of human ACTH/adrenocorticotropin which is the major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.

Available downloads:

 
Sequence:SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Delivery:2-3 days
C-Terminus:OH
N-Terminus:H
Purity:95%
Amount:5 mg
Counter Ion:TFA
Species:HUMAN
####
    HEL 11-25
    From €115.00 *
    HPV16 (L2) HPV16 (L2)
    €291.00 *
    EBNA 3a (596-604)
    From €57.50 *
    NS5 465-479
    From €115.00 *
    LLO 91-99 (H-2 Kd)
    From €57.50 *
    HPV16 (L1) HPV16 (L1)
    €291.00 *
    fn20 env 122-141
    From €195.50 *
    HPV E6 133–142
    From €57.50 *
    LCMV NP 309-328
    From €195.50 *
    NRP-V7 (H-2Kd)
    From €57.50 *
    HDV 192-200
    From €57.50 *
    Viewed
    ACTH (1-39) (human)