beta-Amyloid (11-40)
- Description Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools.… More
- TechData Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools.… More
- Documents Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools.… More
- References
Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.
| Sequence: | EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV | |
| Gene: | APP | |
| Delivery: | 1-3 days | |
| C-Terminus: | OH | |
| N-Terminus: | H | |
| Amount: | 1 mg | |
| Counter Ion: | TFA | |
| Protein: | Amyloid-beta precursor protein | |
| UniProt Id: | P05067 | |
| Species: | Human | |
| Allele: | ||
| Application : | ELISPOT, Flow Cytometry, Western Blotting | |
| Indication : | Neuroscience | |
| Purity : | 95% HPLC-MS |
Protocols and Tips
Data sheets
Safety data sheet poly peptides:For your convenience, we have compiled a selection of publications
where our peptide products have been employed:
Publications >
€266.20*
Available, delivery time: 1-3 days
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.
Purity: 95% HPLC-MS
More beta-Amyloid peptides