[beta]-Amyloid (11- 40)

[beta]-Amyloid (11- 40)
€264.50 *

Prices plus VAT plus shipping costs

Delivery time 2-3 days
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.

Amount in mg:

5 mg

  • Order number: EP10013_5
Description Technical data Documents Accessories
Description
Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42)... more
Close menu
Product information "[beta]-Amyloid (11- 40)"

Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.

Available downloads:
more

Zurück
 
Sequence:EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Gene:APP
Delivery:2-3 days
C-Terminus:OH
N-Terminus:H
Purity:95%
Amount:1 mg
Counter Ion:TFA
Protein:Amyloid-beta precursor protein
Species:Human
Application :Neuroscience
Indication :Alzheimer's Disease
####
    Dokumente - Protokolle - Downloads more
    Zurück

    Protocols and Tips

    Data sheets

     
    Accessories 0
    Customers also bought Customers also viewed
    Customers also bought
    Customers also viewed
    HEL 11-25
    From €115.00 *
    PASD1 694-702 (HLA-A*02:01)
    From €57.50 *
    IL13Ra 345-353 (HLA-A*02:01)
    From €57.50 *
    IGRP 265–273 (HLA-A*02:01)
    From €57.50 *
    IA-2 797-805 (HLA-A*02:01)
    From €57.50 *
    HSP105 180-188 (HLA-A*24:02)
    From €57.50 *
    HPV 16 E7 11-20 (HLA-A*02:01)
    From €57.50 *
    HPV16 E7 82-92 (HLA-A*02:01)
    From €57.50 *
    [beta]-Amyloid (1-39)
    From €345.00 *
    [Ala8] - Humanin, [Ala8] - HN, Shna
    From €92.00 *
    HCMVlfl
    From €57.50 *
    HM1.24 126-134 (HLA-A*02:01)
    From €57.50 *
    EBV BMLF-1 280-288 (HLA-A*02:01)
    From €57.50 *
    OVA-Peptid (323-339) (H-2Kb)
    From €92.00 *
    HCoV-OC43 (Spike Glycoprotein) Peptide Pool HCoV-OC43 (Spike Glycoprotein) Peptide Pool
    €517.50 *
    HHV6 (U90) Peptide Pool HHV6 (U90) Peptide Pool
    €258.75 *
    CEF (advanced) Peptide Pool (>95% HPLC) CEF (advanced) Peptide Pool (>95% HPLC)
    €92.00 *
    Hint!
    M. tuberculosis esxA esaT6 Peptide Pool M. tuberculosis esxA esaT6 Peptide Pool
    €172.50 *
    Elongation factor 2 Peptide Pool Elongation factor 2 Peptide Pool
    €218.50 *
    Mesothelin (290-625) Peptide Pool Mesothelin (290-625) Peptide Pool
    €172.50 *
    HPV18 (L2) Peptide Pool HPV18 (L2) Peptide Pool
    €291.00 *
    SARS-CoV-2 Surface GP A2 1000-1008 (HLA-A*02:01)
    From €92.00 *
    ACTH (1-39) (human)
    From €241.50 *
    EBV LMP-2 340-349 mutant (HLA-A*11:01) 348T
    From €57.50 *
    HPV E6 133–142
    From €57.50 *
    RSV Fusion protein 82-90 (HLA-A*02:01)
    From €57.50 *
    Influenza A virus (A/Puerto Rico/8/1934(H1N1))...
    From €57.50 *
    Influenza NP 418-426 (HLA-B*07:02)
    From €57.50 *
    WT1 235–243 mutant (HLA-A*24:02) 236Y
    From €57.50 *
    JCV-VP1 100-108 (HLA-A*02:01)
    From €57.50 *
    Tyrosinase 146-156 (HLA-A*01:01)
    From €57.50 *
    PAP-3 11-19 (HLA-A*02:01)
    From €57.50 *
    Mena protein (overexpressed in breast cancer)...
    From €57.50 *
    ITGB8 662-670 (HLA-A*02:01)
    From €57.50 *
    HTLV Tax 301-309 (HLA-A*24:02)
    From €57.50 *
    EBV LMP1 159-167 (HLA-A*02:01)
    From €57.50 *
    EBNA 3a (596-604)
    From €57.50 *
    HPV E6 48-57 (H-2 Kb)
    From €57.50 *
    MBP (54-72) human
    From €195.50 *
    HPV E6 29-38 (HLA-A*02:01)
    From €57.50 *
    Viewed
    This website uses cookies to ensure you get the best experience on our website.
    Accept
    [beta]-Amyloid (11- 40)