LL - 37

€201.25 *

Prices plus VAT plus shipping costs

Delivery time 3 weeks
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.

Amount in mg:

5 mg

  • EP11651_1
The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic... more
Product information "LL - 37"

The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). Antimicrobial peptide LL-37,ï¾  belongsï¾  to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human.ï¾  It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds.ï¾  Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution.

Available downloads:

 
Sequence:[LL-37, 37 aa]
Delivery: 3 weeks
C-Terminus:OH
N-Terminus:H
Purity:95%
Amount:1 mg
Counter Ion:TFA
Synonyme :other name: Baculoviral IAP repeat-containing protein 7 (280-289); ML-IAP 280-289
####
    Viewed
    LL - 37