ACTH (1-39) (human)

ACTH (1-39) (human)
€517.50 *

Prices plus VAT plus shipping costs

Delivery time 2-3 days
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.

Amount in mg:

5 mg

  • Order number: EP10644_5
Description Technical data Documents Accessories
Description
ACTH (1-39), human is a synthetic peptide corresponding to the first 39 amino acids of human... more
Close menu
Product information "ACTH (1-39) (human)"

ACTH (1-39), human is a synthetic peptide corresponding to the first 39 amino acids of human ACTH/adrenocorticotropin which is the major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.

Available downloads:
more

Zurück
 
Sequence:SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Delivery:2-3 days
C-Terminus:OH
N-Terminus:H
Purity:95%
Amount:5 mg
Counter Ion:TFA
Species:HUMAN
####
    Dokumente - Protokolle - Downloads more
    Zurück

    Protocols and Tips

    Data sheets

     
    Accessories 0
    Customers also bought Customers also viewed
    Customers also bought
    Customers also viewed
    Hint!
    M. tuberculosis esxA esaT6 Peptide Pool M. tuberculosis esxA esaT6 Peptide Pool
    €172.50 *
    Elongation factor 2 Peptide Pool Elongation factor 2 Peptide Pool
    €218.50 *
    Mesothelin (290-625) Peptide Pool Mesothelin (290-625) Peptide Pool
    €172.50 *
    HEL 11-25
    From €115.00 *
    HCMVlfl
    From €57.50 *
    Influenza A NP 366-374 (H-2 Db)
    From €57.50 *
    HCMVos
    From €57.50 *
    f22 Peptide Pool f22 Peptide Pool
    €172.50 *
    crf1 Peptide Pool crf1 Peptide Pool
    €172.50 *
    HUMAN WT1 Peptide Pool HUMAN WT1 Peptide Pool
    €207.00 *
    HUMAN Survivin Peptide Pool HUMAN Survivin Peptide Pool
    €172.50 *
    Hint!
    HHV5 UL44 Peptide Pool HHV5 UL44 Peptide Pool
    €230.00 *
    Hint!
    HIV-1 B Gag Peptide Pool HIV-1 B Gag Peptide Pool
    €230.00 *
    Hint!
    M. tuberculosis esxB CFP-10 Peptide Pool M. tuberculosis esxB CFP-10 Peptide Pool
    €172.50 *
    Hint!
    M. tuberculosis Ag85B Peptide Pool M. tuberculosis Ag85B Peptide Pool
    €201.25 *
    Hint!
    M. tuberculosis Alpha-crystallin Peptide Pool M. tuberculosis Alpha-crystallin Peptide Pool
    €172.50 *
    Hint!
    M. tuberculosis hspX Peptide Pool M. tuberculosis hspX Peptide Pool
    €172.50 *
    Hint!
    BA.4/BA.5 Omicron full length SCoV2 (Spike Glycoprotein) Peptide Pool BA.4/BA.5 Omicron full length SCoV2 (Spike...
    €805.00 *
    Delta Variant B.1.617.2 SCoV2 wt (Spike Glycoprotein) Peptide Pool Delta Variant B.1.617.2 SCoV2 wt (Spike...
    €230.00 *
    SARS-CoV-2 Surface GP A2 1000-1008 (HLA-A*02:01)
    From €92.00 *
    Kappa Variant B.1.617.1 SCoV2 (Spike Glycoprotein) Peptide Pool Kappa Variant B.1.617.1 SCoV2 (Spike...
    €230.00 *
    Theta Variant P.3 SCoV2 (Spike Glycoprotein) Peptide Pool Theta Variant P.3 SCoV2 (Spike Glycoprotein)...
    €230.00 *
    Zeta Variant P.2 SCoV2 (Spike Glycoprotein) Peptide Pool Zeta Variant P.2 SCoV2 (Spike Glycoprotein)...
    €230.00 *
    Gamma Variant P.1 SCoV2 (Spike Glycoprotein) Peptide Pool Gamma Variant P.1 SCoV2 (Spike Glycoprotein)...
    €230.00 *
    Alpha Variant B.1.1.7 SCoV2 (Spike Glycoprotein) Peptide Pool Alpha Variant B.1.1.7 SCoV2 (Spike...
    €230.00 *
    HBV Sub Peptide Pool (>95% HPLC) HBV Sub Peptide Pool (>95% HPLC)
    €63.25 *
    GAD65 555-567 (DRB1*04:01)
    From €149.50 *
    NS4b 77-91
    From €115.00 *
    RSV Fusion protein 538-546 (HLA-A*02:01)
    From €57.50 *
    RSV Fusion protein 191-199 (HLA-A*02:01)
    From €57.50 *
    PSMA 178-186 (HLA-A*24:02)
    From €57.50 *
    TRP2 181-190 (HLA-A*01:01)
    From €57.50 *
    EBV EBNA 3C 258-266...
    From €57.50 *
    Influenza NP 418-426 (HLA-B*07:02)
    From €57.50 *
    JCV-VP1 100-108 (HLA-A*02:01)
    From €57.50 *
    TTK-567 (HLA-A*24:02)
    From €57.50 *
    PRAME 300–309 (HLA-A*02:01)
    From €57.50 *
    PAP-3 11-19 (HLA-A*02:01)
    From €57.50 *
    Mesothelin 20-28 (HLA-A*02:01)
    From €57.50 *
    Mesothelin 429-437 (HLA-A*01:01)
    From €57.50 *
    Viewed
    This website uses cookies to ensure you get the best experience on our website.
    Accept
    ACTH (1-39) (human)