peptides&elephants sells products and services to companies and non-profit institutions only and not to individuals without business or academic affiliations.
Name | Sequence | Amount | Purity | Order# | Price | |
---|---|---|---|---|---|---|
[beta]-Amyloid (1-14) , mouse, rat | DAEFGHDSGFEVRH | 1 mg | ≥ 95% | EP10016_1 | 130 EUR | Add to cart |
DescriptionMolecular Formula: C69H95N21O24 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
[beta]-Amyloid (1-14) , mouse, rat | DAEFGHDSGFEVRH | 5 mg | ≥ 95% | EP10016_5 | 180 EUR | Add to cart |
DescriptionMolecular Formula: C69H95N21O24 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
[beta]-Amyloid (1-16) | DAEFRHDSGYEVHHQK | 1 mg | ≥ 95% | EP10023_1 | 70 EUR | Add to cart |
DescriptionProteins interactions with reactive oxygen agents may result in covalent modifications of amino acid residues in proteins, formation of protein-protein cross-linkages and oxidation of the protein backbone resulting in protein fragmentation. Oxidation targets for Aß(1-16) are the histidine residues coordinated to the metal ions. Copper is bound to Aß in senile plaque of Alzheimer’s disease with Aß (1-16) taking part in the coordination of the Cu2+ ions. Cu2+ and Zn2+ are linked with the neurotoxicity of Aß and free radical damage. DAEFRHDSGYEVHHQK is a linear peptidic epitope (epitope ID7491) studied as part of Amyloid beta A4 protein from Homo sapiens (human) and Gamma-secretase C-terminal fragment 59 from Homo sapiens (human). This epitope has been studied for immune reactivity, tested in Synonym: β-Amyloid (1-16), human Delivery Format: The product is supplied freeze dried as trifluoracetate salts. sterile and endotoxin free |
||||||
[beta]-Amyloid (1-16) | DAEFRHDSGYEVHHQK | 5 mg | ≥ 95% | EP10023_5 | 175 EUR | Add to cart |
DescriptionProteins interactions with reactive oxygen agents may result in covalent modifications of amino acid residues in proteins, formation of protein-protein cross-linkages and oxidation of the protein backbone resulting in protein fragmentation. Oxidation targets for Aß(1-16) are the histidine residues coordinated to the metal ions. Copper is bound to Aß in senile plaque of Alzheimer’s disease with Aß (1-16) taking part in the coordination of the Cu2+ ions. Cu2+ and Zn2+ are linked with the neurotoxicity of Aß and free radical damage. DAEFRHDSGYEVHHQK is a linear peptidic epitope (epitope ID7491) studied as part of Amyloid beta A4 protein from Homo sapiens (human) and Gamma-secretase C-terminal fragment 59 from Homo sapiens (human). This epitope has been studied for immune reactivity, tested in Synonym: β-Amyloid (1-16), human Delivery Format: The product is supplied freeze dried as trifluoracetate salts. sterile and endotoxin free
|
||||||
[beta]-Amyloid (1-40), rat | DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV | 1 mg | ≥ 95% | EP10059_1 | 300 EUR | Add to cart |
DescriptionMolecular Weight: 4233.8 Delivery Format: The product is supplied freeze dried as trifluoracetate salt. sterile and endotoxin free Links
beta-Amyloid protein induces platelet aggregation and supports platelet adhesion; Kowalska MA & Badellino K, Biochem Biophys Res Commun 205:1829-35 (1994)
Human and rodent Alzheimer beta-amyloid peptides acquire distinct conformations in membrane-mimicking solvents; Otvos L et al.; Eur J Biochem 211:249-57 (1993) |
||||||
[beta]-Amyloid (1-40), rat | DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV | 5 mg | ≥ 95% | EP10059_5 | 700 EUR | Add to cart |
DescriptionMolecular Weight: 4233.8 Delivery Format: The product is supplied freeze dried as trifluoracetate salt. sterile and endotoxin free Links
beta-Amyloid protein induces platelet aggregation and supports platelet adhesion; Kowalska MA & Badellino K, Biochem Biophys Res Commun 205:1829-35 (1994)
Human and rodent Alzheimer beta-amyloid peptides acquire distinct conformations in membrane-mimicking solvents; Otvos L et al.; Eur J Biochem 211:249-57 (1993) |
||||||
[beta]-Casomorphin (1-7), bovine | YPFPGPI | 1 mg | ≥ 95% | EP10086_1 | 50 EUR | Add to cart |
Descriptionβ-Casomorphin-7 is a milk opioid peptide derived from fragment 60-66 of bovine beta-Casein. It strongly stimulates mucin secretion in the rat jejunum through a nervous pathway and mu-opioid receptor activation. The presence of the Tyr-Pro aromatic sequence makes the peptide selective for the mu receptor while the high contents of proline residues in the sequence makes the peptide resistant to degradation by gastrointestinal enzymes. Synonyms: β-Casomorphin-7 (bovine), β-Casomorphin (1-7), bovine Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
[beta]-Casomorphin (1-7), bovine | YPFPGPI | 5 mg | ≥ 95% | EP10086_5 | 100 EUR | Add to cart |
Descriptionβ-Casomorphin-7 is a milk opioid peptide derived from fragment 60-66 of bovine beta-Casein. It strongly stimulates mucin secretion in the rat jejunum through a nervous pathway and mu-opioid receptor activation. The presence of the Tyr-Pro aromatic sequence makes the peptide selective for the mu receptor while the high contents of proline residues in the sequence makes the peptide resistant to degradation by gastrointestinal enzymes. Synonyms: β-Casomorphin-7 (bovine), β-Casomorphin (1-7), bovine Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
[Trp63, 64] - C3a (63 - 77) | WWGKKYRASKLGLAR | 1 mg | ≥ 95% | EP10219_1 | 90 EUR | Add to cart |
Description(Trp63,Trp64)-C3a (63-77), synthetic superagonist analog of complement 3a, was 12-15 times more active than natural C3a. This peptide, which is a C-terminal analogue of the complement factor C3a, acts as an agonist to the C3a receptor. It is derived from the fifteen C-terminal residues (6-77) of C3a. In in vitro studies, both C 3a and this peptide have been shown to selectively bind to C3aRs and induce degranulation of C3aR-transfeted RBL-2H3 cells. There was also a rapid, transient and concentration-dependent hypertensive response observed in rats when infused intravenously with C3a and this peptide. Molecular Formula: C86H134N26O18 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
[Trp63, 64] - C3a (63 - 77) | WWGKKYRASKLGLAR | 5 mg | ≥ 95% | EP10219_5 | 225 EUR | Add to cart |
Description(Trp63,Trp64)-C3a (63-77), synthetic superagonist analog of complement 3a, was 12-15 times more active than natural C3a. This peptide, which is a C-terminal analogue of the complement factor C3a, acts as an agonist to the C3a receptor. It is derived from the fifteen C-terminal residues (6-77) of C3a. In in vitro studies, both C 3a and this peptide have been shown to selectively bind to C3aRs and induce degranulation of C3aR-transfeted RBL-2H3 cells. There was also a rapid, transient and concentration-dependent hypertensive response observed in rats when infused intravenously with C3a and this peptide. Molecular Formula: C86H134N26O18 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
3x FLAG | DYKDDDDKDYKDDDDKDYKDDDDK | 1 mg | ≥ 95% | EP07918_1 | 170 EUR | Add to cart |
DescriptionThis peptide represents a sequence of triple DYKDDDDK epitopes that is used in studying the function and structure of proteins. It has an increased sensitivity to the anti- DYKDDDDK M2 antibody and can be detected at lower abundance than the octomeric DYKDDDDK tag. A FLAG-tag can be used in many different assays that require recognition by an antibody. If there is no antibody against a given protein, adding a FLAG-tag to a protein allows the protein to be studied with an antibody against the FLAG sequence. Molecular Formula: C123H176N30O58 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
3x FLAG | DYKDDDDKDYKDDDDKDYKDDDDK | 5 mg | ≥ 95% | EP07918_5 | 230 EUR | Add to cart |
DescriptionThis peptide represents a sequence of triple DYKDDDDK epitopes that is used in studying the function and structure of proteins. It has an increased sensitivity to the anti- DYKDDDDK M2 antibody and can be detected at lower abundance than the octomeric DYKDDDDK tag. A FLAG-tag can be used in many different assays that require recognition by an antibody. If there is no antibody against a given protein, adding a FLAG-tag to a protein allows the protein to be studied with an antibody against the FLAG sequence. Molecular Formula: C123H176N30O58 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
ABL1 40-48 (HLA-A*02:01) | QQAHCLWCV | 1 mg | ≥ 95% | EP11076_1 | 50 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 1087.30 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
ABL1 40-48 (HLA-A*02:01) | QQAHCLWCV | 5 mg | ≥ 95% | EP11076_5 | 100 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 1087.30 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
ABL1 44-53 (HLA-A*02:01) | CLWCVPQLR | 1 mg | ≥ 95% | EP11075_1 | 50 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 1117.41 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
ABL1 44-53 (HLA-A*02:01) | CLWCVPQLR | 5 mg | ≥ 95% | EP11075_5 | 100 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 1117.41 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
ACPP 299-307 (HLA-A*02:01) | ALNVYNGLL | 1 mg | ≥ 95% | EP10770_1 | 50 EUR | Add to cart |
DescriptionAllele: A*02:01 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
ACPP 299-307 (HLA-A*02:01) | ALNVYNGLL | 5 mg | ≥ 95% | EP10770_5 | 100 EUR | Add to cart |
DescriptionAllele: A*02:01 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
ACTH (1-10), human | SYSMEHFRWG | 1 mg | ≥ 95% | EP10595_1 | 50 EUR | Add to cart |
DescriptionAdrenocorticotropic Hormones (ACTH). ACTH stimulates the adrenal cortex and the secretion of glucocorticoids such as cortisol. Amino acids 1-10 of human adrenocorticotropic hormone (ACTH). ACTH, also known as corticotropin, is a tropic hormone produced and secreted by the anterior pituitary gland and member of the melanocortins peptide family. ACTH is cleaved from the precursor proopiomelanocortin (POMC). ACTH is an important component of the hypothalamic-pituitary-adrenal (HPA) axis and is often produced in response to biological stress. ACTH acts to increase the production and release of cortisol via its interaction with the ACTH receptor; ACTHR, also known as melanocortin type 2 receptor (MC2R). Receptor activation increases the intracellular concentration of cAMP via adenylyl cyclase. Abnormal ACTH levels in the body has been linked to primary adrenal insufficiency/Addison's disease, Cushing's disease and secondary adrenal insufficiency. Molecular Weight: 1299.44 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free Links
First clinical impressions with an ACTH analog (HOE 427) in the treatment of Alzheimer's disease; Siegfried KR; Ann N Y Acad Sci 640:280-3 (1991)
Centrally administered N-terminal fragments of ACTH (1-10, 4-10, 4-9) display convulsant properties in rabbits; Tartara A et al.; Peptides 4:315-8 (0) (1983) |
||||||
ACTH (1-10), human | SYSMEHFRWG | 5 mg | ≥ 95% | EP10595_5 | 100 EUR | Add to cart |
DescriptionAdrenocorticotropic Hormones (ACTH). ACTH stimulates the adrenal cortex and the secretion of glucocorticoids such as cortisol. Amino acids 1-10 of human adrenocorticotropic hormone (ACTH). ACTH, also known as corticotropin, is a tropic hormone produced and secreted by the anterior pituitary gland and member of the melanocortins peptide family. ACTH is cleaved from the precursor proopiomelanocortin (POMC). ACTH is an important component of the hypothalamic-pituitary-adrenal (HPA) axis and is often produced in response to biological stress. ACTH acts to increase the production and release of cortisol via its interaction with the ACTH receptor; ACTHR, also known as melanocortin type 2 receptor (MC2R). Receptor activation increases the intracellular concentration of cAMP via adenylyl cyclase. Abnormal ACTH levels in the body has been linked to primary adrenal insufficiency/Addison's disease, Cushing's disease and secondary adrenal insufficiency. Molecular Weight: 1299.44 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free Links
First clinical impressions with an ACTH analog (HOE 427) in the treatment of Alzheimer's disease; Siegfried KR; Ann N Y Acad Sci 640:280-3 (1991)
Centrally administered N-terminal fragments of ACTH (1-10, 4-10, 4-9) display convulsant properties in rabbits; Tartara A et al.; Peptides 4:315-8 (0) (1983) |
||||||
ACTH (1-24), human | SYSMEHFRWGKPVGKKRRPVKVYP | 1 mg | ≥ 95% | EP10598_1 | 110 EUR | Add to cart |
DescriptionAdrenocorticotropic hormone (ACTH), also known as corticotropin (INN, BAN) (brand names Acortan, ACTH, Acthar, Acton, Cortigel, Trofocortina), is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of cortisol. Primary adrenal insufficiency, also called Addison's disease, occurs when adrenal gland production of cortisol is chronically deficient, resulting in chronically elevated ACTH levels; when a pituitary tumor is the cause of elevated ACTH (from the anterior pituitary) this is known as Cushing's disease and the constellation of signs and symptoms of the excess cortisol (hypercortisolism) is known as Cushing's syndrome. Conversely, deficiency of ACTH is a cause of secondary adrenal insufficiency, often as a result of hypopituitarism. ACTH is also related to the circadian rhythm in many organisms. Neuropeptide ACTH (adenocorticotropin) amino acids (1-39), is the natural cleavage product from POMC (proopimelanocortin) processing; however, the first 24-amino acid sequence from the carboxyl end, ACTH (1-24) has full biological activity of the (1-39) peptide. Both ACTH (1-24) and (1-39) possess neurotropic activity. Potent ACTH/MC2 receptor agonist (EC50 = 5.5 nM). Stimulates glucocorticoid release from adrenal glands. Multiple biological activities. Anticancer reagent. Active in vivo. Amino acids 1-24 of human adrenocorticotropic hormone (ACTH), induces glucocorticoid production by adrenal cells with the same potency as full length ACTH. Molecular Formula: C136H210N40O31S Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
ACTH (1-24), human | SYSMEHFRWGKPVGKKRRPVKVYP | 5 mg | ≥ 95% | EP10598_5 | 230 EUR | Add to cart |
DescriptionAdrenocorticotropic hormone (ACTH), also known as corticotropin (INN, BAN) (brand names Acortan, ACTH, Acthar, Acton, Cortigel, Trofocortina), is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of cortisol. Primary adrenal insufficiency, also called Addison's disease, occurs when adrenal gland production of cortisol is chronically deficient, resulting in chronically elevated ACTH levels; when a pituitary tumor is the cause of elevated ACTH (from the anterior pituitary) this is known as Cushing's disease and the constellation of signs and symptoms of the excess cortisol (hypercortisolism) is known as Cushing's syndrome. Conversely, deficiency of ACTH is a cause of secondary adrenal insufficiency, often as a result of hypopituitarism. ACTH is also related to the circadian rhythm in many organisms. Neuropeptide ACTH (adenocorticotropin) amino acids (1-39), is the natural cleavage product from POMC (proopimelanocortin) processing; however, the first 24-amino acid sequence from the carboxyl end, ACTH (1-24) has full biological activity of the (1-39) peptide. Both ACTH (1-24) and (1-39) possess neurotropic activity. Potent ACTH/MC2 receptor agonist (EC50 = 5.5 nM). Stimulates glucocorticoid release from adrenal glands. Multiple biological activities. Anticancer reagent. Active in vivo. Amino acids 1-24 of human adrenocorticotropic hormone (ACTH), induces glucocorticoid production by adrenal cells with the same potency as full length ACTH. Molecular Formula: C136H210N40O31S Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Adenovirus 5 Hexon 886-894 (HLA-A*01:01) | TDLGQNLLY | 1 mg | ≥ 95% | EP10774_1 | 50 EUR | Add to cart |
DescriptionTDLGQNLLY is a linear peptidic epitope studied as part of Hexon protein from Human mastadenovirus C. This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay Allele: A*01:01 Molecular Weight: 1036.16 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Adenovirus 5 Hexon 886-894 (HLA-A*01:01) | TDLGQNLLY | 5 mg | ≥ 95% | EP10774_5 | 100 EUR | Add to cart |
DescriptionTDLGQNLLY is a linear peptidic epitope studied as part of Hexon protein from Human mastadenovirus C. This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay Allele: A*01:01 Molecular Weight: 1036.16 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Adpgk Neoepitope (H-2D(b)) | ASMTNMELM | 1 mg | ≥ 95% | EP11850_1 | 50 EUR | Add to cart |
DescriptionAllele: H-2Db Molecular Weight: 1027.25 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Adpgk Neoepitope (H-2D(b)) | ASMTNMELM | 5 mg | ≥ 95% | EP11850_5 | 100 EUR | Add to cart |
DescriptionAllele: H-2Db Molecular Weight: 1027.25 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
ADV hexon 114-124 (HLA-B*07:02) | KPYSGTAYNAL | 1 mg | ≥ 95% | EP07881_1 | 50 EUR | Add to cart |
DescriptionKPYSGTAYNAL is a linear peptidic epitope (epitope ID174600) studied as part of Hexon protein from Human mastadenovirus C (Human adenovirus C). This epitope has been studied for immune reactivity and tested in T cell assays. Allele: HLA-B*07:02 Molecular Weight: 1184.32 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free
|
||||||
ADV hexon 114-124 (HLA-B*07:02) | KPYSGTAYNAL | 5 mg | ≥ 95% | EP07881_5 | 100 EUR | Add to cart |
DescriptionKPYSGTAYNAL is a linear peptidic epitope (epitope ID174600) studied as part of Hexon protein from Human mastadenovirus C (Human adenovirus C). This epitope has been studied for immune reactivity and tested in T cell assays. Allele: HLA-B*07:02 Molecular Weight: 1184.32 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
ADV hexon 320-329 (HLA-B*35:01) | MPNRPNYIAF | 1 mg | ≥ 95% | EP07882_1 | 50 EUR | Add to cart |
DescriptionAllele: B*07:02 Molecular Weight: 1222.44 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
ADV hexon 320-329 (HLA-B*35:01) | MPNRPNYIAF | 5 mg | ≥ 95% | EP07882_5 | 100 EUR | Add to cart |
DescriptionAllele: B*07:02 Molecular Weight: 1222.44 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
ADV hexon 37-45 (HLA-A*24:02) | TYFSLNNKF | 1 mg | ≥ 95% | EP07880_1 | 50 EUR | Add to cart |
DescriptionTYFSLNNKF is a linear peptidic epitope (epitope ID67338) studied as part of Hexon protein from Human mastadenovirus C (Human adenovirus C). This epitope has been studied for immune reactivity and tested in Allele: HLA-A*24:02 Molecular Weight: 1133.27 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
ADV hexon 37-45 (HLA-A*24:02) | TYFSLNNKF | 5 mg | ≥ 95% | EP07880_5 | 100 EUR | Add to cart |
DescriptionTYFSLNNKF is a linear peptidic epitope (epitope ID67338) studied as part of Hexon protein from Human mastadenovirus C (Human adenovirus C). This epitope has been studied for immune reactivity and tested in Allele: HLA-A*24:02 Molecular Weight: 1133.27 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
ADV Hexon 917-925 (HLA-A*02:01) | YVLFEVFDV | 1 mg | ≥ 95% | EP07914_1 | 50 EUR | Add to cart |
DescriptionSingle peptide (YVLFEVFDV) for stimulation of human ADV Hexon (917-925)-specific CD8+ T cells. Allele: HLA-A*02:01 Molecular Weight: 1130.32 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
ADV Hexon 917-925 (HLA-A*02:01) | YVLFEVFDV | 5 mg | ≥ 95% | EP07914_5 | 100 EUR | Add to cart |
DescriptionSingle peptide (YVLFEVFDV) for stimulation of human ADV Hexon (917-925)-specific CD8+ T cells. Allele: HLA-A*02:01 Molecular Weight: 1130.32 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Anti-H60a 39-46 (H-2Kb) | LTFNYRNL | 1 mg | ≥ 95% | EP11648_1 | 50 EUR | Add to cart |
DescriptionLTFNYRNL is a linear peptidic epitope (epitope ID139167) studied as part of Histocompatibility-60b from Mus musculus (mouse). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Antigen peptide composed of Histocompatibility antigen 60-derived peptide of LTFNYRNL sequence covering 39-46 and H-2Kb molecule. The peptide recognizes mouse CD8 T cells, and can be used in the analysis of individual antigen-specific T cells. Allele: H-2Kb Molecular Weight: 1040.20 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Anti-H60a 39-46 (H-2Kb) | LTFNYRNL | 5 mg | ≥ 95% | EP11648_5 | 100 EUR | Add to cart |
DescriptionLTFNYRNL is a linear peptidic epitope (epitope ID139167) studied as part of Histocompatibility-60b from Mus musculus (mouse). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Antigen peptide composed of Histocompatibility antigen 60-derived peptide of LTFNYRNL sequence covering 39-46 and H-2Kb molecule. The peptide recognizes mouse CD8 T cells, and can be used in the analysis of individual antigen-specific T cells. Allele: H-2Kb Molecular Weight: 1040.20 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Arg9 | RRRRRRRRR | 1 mg | ≥ 95% | EP09843_1 | 50 EUR | Add to cart |
DescriptionThis is a peptide comprising of 9 arginine residues. It has been shown that poly-Arg peptides composed of 9 arginine residues are able to efficiently translocate across cells. It has also been shown in model systems that Arg-9 translocation involves nucleation of transient pores enabling flow of ions across the membrane and that it's electrostatic attraction to the phosphate groups of membranes is a key property for its translocation. This poly-Arg, rich cell-penetrating peptide, is capable of traversing the plasma membranes of eukaryotic cells. Molecular Weight: 1423.72 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Arg9 | RRRRRRRRR | 5 mg | ≥ 95% | EP09843_5 | 100 EUR | Add to cart |
DescriptionThis is a peptide comprising of 9 arginine residues. It has been shown that poly-Arg peptides composed of 9 arginine residues are able to efficiently translocate across cells. It has also been shown in model systems that Arg-9 translocation involves nucleation of transient pores enabling flow of ions across the membrane and that it's electrostatic attraction to the phosphate groups of membranes is a key property for its translocation. This poly-Arg, rich cell-penetrating peptide, is capable of traversing the plasma membranes of eukaryotic cells. Molecular Weight: 1423.72 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
B8R 20-27 (H-2 Kb) | TSYKFESV | 1 mg | ≥ 95% | EP08851_1 | 50 EUR | Add to cart |
DescriptionTSYKFESV is a linear peptidic epitope (epitope ID66504) studied as part of Soluble interferon gamma receptor B8 from Vaccinia virus (vaccinia virus VV), interferon-gamma binding protein C4R from Ectromelia virus (Ectromelia mousepox virus) and CPXV202 protein from Cowpox virus. This epitope has been studied for immune reactivity and tested in This is amino acids 20 to 27 fragment of B8R, a vaccinia virus (VV) gene that encodes a secreted protein related to gamma interferon receptor (IFN-?). B8R binding to IFN-? neutralizes its antiviral activity. Allele: H-2Kb Molecular Weight: 960.05 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free
|
||||||
B8R 20-27 (H-2 Kb) | TSYKFESV | 5 mg | ≥ 95% | EP08851_5 | 100 EUR | Add to cart |
DescriptionTSYKFESV is a linear peptidic epitope (epitope ID66504) studied as part of Soluble interferon gamma receptor B8 from Vaccinia virus (vaccinia virus VV), interferon-gamma binding protein C4R from Ectromelia virus (Ectromelia mousepox virus) and CPXV202 protein from Cowpox virus. This epitope has been studied for immune reactivity and tested in This is amino acids 20 to 27 fragment of B8R, a vaccinia virus (VV) gene that encodes a secreted protein related to gamma interferon receptor (IFN-?). B8R binding to IFN-? neutralizes its antiviral activity. Allele: H-2Kb Molecular Weight: 960.05 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BA46 194-202 (HLA-A*02:01) | NLFETPVEA | 1 mg | ≥ 95% | EP11078_1 | 50 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 1019.13 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BA46 194-202 (HLA-A*02:01) | NLFETPVEA | 5 mg | ≥ 95% | EP11078_5 | 100 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 1019.13 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BA46 97-106 (HLA-A*02:01) | GLQHWVPEL | 1 mg | ≥ 95% | EP11077_1 | 50 EUR | Add to cart |
DescriptionThis gene encodes a preproprotein that is proteolytically processed to form multiple protein products. The major encoded protein product, lactadherin, is a membrane glycoprotein that promotes phagocytosis of apoptotic cells. This protein has also been implicated in wound healing, autoimmune disease, and cancer. Lactadherin can be further processed to form a smaller cleavage product, medin, which comprises the major protein component of aortic medial amyloid (AMA). Alternative splicing results in multiple transcript variants. Allele: A*02:01 Molecular Weight: 1078.25 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BA46 97-106 (HLA-A*02:01) | GLQHWVPEL | 5 mg | ≥ 95% | EP11077_5 | 100 EUR | Add to cart |
DescriptionThis gene encodes a preproprotein that is proteolytically processed to form multiple protein products. The major encoded protein product, lactadherin, is a membrane glycoprotein that promotes phagocytosis of apoptotic cells. This protein has also been implicated in wound healing, autoimmune disease, and cancer. Lactadherin can be further processed to form a smaller cleavage product, medin, which comprises the major protein component of aortic medial amyloid (AMA). Alternative splicing results in multiple transcript variants. Allele: A*02:01 Molecular Weight: 1078.25 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BAP31 167-175 (HLA-A*02:01) | KLDVGNAEV | 1 mg | ≥ 95% | EP11079_1 | 50 EUR | Add to cart |
DescriptionKLDVGNAEV is a linear peptidic epitope (epitope ID445492) studied as part of B-cell receptor-associated protein 31 from Homo sapiens (human). This epitope has been studied for immune reactivity and tested in MHC ligand assays Allele: A*02:01 Molecular Weight: 944.05 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BAP31 167-175 (HLA-A*02:01) | KLDVGNAEV | 5 mg | ≥ 95% | EP11079_5 | 100 EUR | Add to cart |
DescriptionKLDVGNAEV is a linear peptidic epitope (epitope ID445492) studied as part of B-cell receptor-associated protein 31 from Homo sapiens (human). This epitope has been studied for immune reactivity and tested in MHC ligand assays Allele: A*02:01 Molecular Weight: 944.05 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Bcl-2 180-189 (HLA-A*02:01) | YLNRHLHTWI | 1 mg | ≥ 95% | EP11083_1 | 50 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 1352.57 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Bcl-2 180-189 (HLA-A*02:01) | YLNRHLHTWI | 5 mg | ≥ 95% | EP11083_5 | 100 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 1352.57 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCL-2 208-217 (HLA-A*02:01) | PLFDFSWLSL | 1 mg | ≥ 95% | EP11081_1 | 50 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 1224.43 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCL-2 208-217 (HLA-A*02:01) | PLFDFSWLSL | 5 mg | ≥ 95% | EP11081_5 | 100 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 1224.43 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCL-2 85-93 (HLA-A*02:01) | ALSPVPPVV | 1 mg | ≥ 95% | EP11080_1 | 50 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 878.09 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free
|
||||||
BCL-2 85-93 (HLA-A*02:01) | ALSPVPPVV | 5 mg | ≥ 95% | EP11080_5 | 100 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 878.09 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCL-2A1 15-23 (HLA-A*24:02) | DYLQYVLQI | 1 mg | ≥ 95% | EP11084_1 | 50 EUR | Add to cart |
DescriptionDYLQYVLQI is a linear peptidic epitope (epitope ID 140993) studied as part of Bcl-2-related protein A1 from Homo sapiens (human). This epitope has been studied for immune reactivity in and was tested in T cell assays Allele: A*24:02 Molecular Weight: 1154.34 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCL-2A1 15-23 (HLA-A*24:02) | DYLQYVLQI | 5 mg | ≥ 95% | EP11084_5 | 100 EUR | Add to cart |
DescriptionDYLQYVLQI is a linear peptidic epitope (epitope ID 140993) studied as part of Bcl-2-related protein A1 from Homo sapiens (human). This epitope has been studied for immune reactivity in and was tested in T cell assays Allele: A*24:02 Molecular Weight: 1154.34 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCL-2L1 165-173 (HLA-A*03:01) | RIAAWMATY | 1 mg | ≥ 95% | EP11085_1 | 50 EUR | Add to cart |
DescriptionAllele: A*03:01 Molecular Weight: 1082.30 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCL-2L1 165-173 (HLA-A*03:01) | RIAAWMATY | 5 mg | ≥ 95% | EP11085_5 | 100 EUR | Add to cart |
DescriptionAllele: A*03:01 Molecular Weight: 1082.30 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCL2-like 1 173-182 (HLA-A*02:01) | YLNDHLEPWI | 1 mg | ≥ 95% | EP11086_1 | 50 EUR | Add to cart |
DescriptionAllele: A*03:01 Molecular Weight: 1299.46 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCL2-like 1 173-182 (HLA-A*02:01) | YLNDHLEPWI | 5 mg | ≥ 95% | EP11086_5 | 100 EUR | Add to cart |
DescriptionAllele: A*03:01 Molecular Weight: 1299.46 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCR-ABL (HLA-A*02:01) | GVRGRVEEI | 1 mg | ≥ 95% | EP11087_1 | 50 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 1014.16 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCR-ABL (HLA-A*02:01) | GVRGRVEEI | 5 mg | ≥ 95% | EP11087_5 | 100 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 1014.16 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCR-ABL 19-27 (HLA-B*27:01) | GFKQSSKAL | 1 mg | ≥ 95% | EP11090_1 | 50 EUR | Add to cart |
DescriptionTumor Antigen-derived Peptide. GFKQSSKAL is a linear peptidic epitope (epitope ID19558) studied as part of Other Homo sapiens (human) protein from Homo sapiens (human), tested in MHC ligand assay Allele: B*27:01 Molecular Weight: 965.11 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCR-ABL 19-27 (HLA-B*27:01) | GFKQSSKAL | 5 mg | ≥ 95% | EP11090_5 | 100 EUR | Add to cart |
DescriptionTumor Antigen-derived Peptide. GFKQSSKAL is a linear peptidic epitope (epitope ID19558) studied as part of Other Homo sapiens (human) protein from Homo sapiens (human), tested in MHC ligand assay Allele: B*27:01 Molecular Weight: 965.11 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCR-ABL 21-29 (HLA-A*03:01) | KQSSKALQR | 1 mg | ≥ 95% | EP11089_1 | 50 EUR | Add to cart |
DescriptionTumor Antigen-derived Peptide KQSSKALQR is a linear peptidic epitope (epitope ID 33075) studied as part of Other Homo sapiens (human) protein from Homo sapiens (human). This epitope has been studied for immune reactivity, and was tested in MHC ligand assays Allele: A*03:01 Molecular Weight: 1045.20 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCR-ABL 21-29 (HLA-A*03:01) | KQSSKALQR | 5 mg | ≥ 95% | EP11089_5 | 100 EUR | Add to cart |
DescriptionTumor Antigen-derived Peptide KQSSKALQR is a linear peptidic epitope (epitope ID 33075) studied as part of Other Homo sapiens (human) protein from Homo sapiens (human). This epitope has been studied for immune reactivity, and was tested in MHC ligand assays Allele: A*03:01 Molecular Weight: 1045.20 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCR-ABL 259-269 (HLA-A*03:01) (HLA-A*11:01) | ATGFKQSSK | 1 mg | ≥ 95% | EP11088_1 | 50 EUR | Add to cart |
DescriptionATGFKQSSK is a linear peptidic epitope (epitope ID 4966) studied as part of Other Homo sapiens (human) protein from Homo sapiens (human), tested in MHC ligand assays Allele: HLA-A*03:01, HLA-A*11:01 Molecular Weight: 953.05 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BCR-ABL 259-269 (HLA-A*03:01) (HLA-A*11:01) | ATGFKQSSK | 5 mg | ≥ 95% | EP11088_5 | 100 EUR | Add to cart |
DescriptionATGFKQSSK is a linear peptidic epitope (epitope ID 4966) studied as part of Other Homo sapiens (human) protein from Homo sapiens (human), tested in MHC ligand assays Allele: HLA-A*03:01, HLA-A*11:01 Molecular Weight: 953.05 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BGLAP (HLA-A*24:02) | LYQWLGAPV | 1 mg | ≥ 95% | EP11092_1 | 50 EUR | Add to cart |
DescriptionAllele: A*24:02 Molecular Weight: 1046.24 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BGLAP (HLA-A*24:02) | LYQWLGAPV | 5 mg | ≥ 95% | EP11092_5 | 100 EUR | Add to cart |
DescriptionAllele: A*24:02 Molecular Weight: 1046.24 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BGLAP 1-10 (HLA-A*02:01) | YLYQWLGAPV | 1 mg | ≥ 95% | EP11091_1 | 50 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 1209.42 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BGLAP 1-10 (HLA-A*02:01) | YLYQWLGAPV | 5 mg | ≥ 95% | EP11091_5 | 100 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 1209.42 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BKV Large T antigen 406-414 (HLA-A*02:01) | VIFDFLHCI | 1 mg | ≥ 95% | EP11094_1 | 50 EUR | Add to cart |
DescriptionVIFDFLHCI is a linear peptidic epitope (epitope ID 68945 ) studied as part of Human polyomavirus 1 protein from Human polyomavirus 1. This epitope has been studied for immune reactivity and was tested in T cell assays and MHC ligand assay Allele: A*02:01 Molecular Weight: 1106.36 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BKV Large T antigen 406-414 (HLA-A*02:01) | VIFDFLHCI | 5 mg | ≥ 95% | EP11094_5 | 100 EUR | Add to cart |
DescriptionVIFDFLHCI is a linear peptidic epitope (epitope ID 68945 ) studied as part of Human polyomavirus 1 protein from Human polyomavirus 1. This epitope has been studied for immune reactivity and was tested in T cell assays and MHC ligand assay Allele: A*02:01 Molecular Weight: 1106.36 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BKV Large T antigen 579-587 (HLA-A*02:01) | LLLIWFRPV | 1 mg | ≥ 95% | EP11093_1 | 50 EUR | Add to cart |
DescriptionBKV LT-ag peptide LLLIWFRPV (HLA-B*0201) for stimulation of human BKV LT-ag(579-587)-specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allele. LLLIWFRPV is a linear peptidic epitope (epitope ID37507) studied as part of Human polyomavirus 1 (polyomavirus BK) protein from Human polyomavirus 1 (BK polyomavirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay. Allele: A*02:01 Molecular Weight: 1156.49 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BKV Large T antigen 579-587 (HLA-A*02:01) | LLLIWFRPV | 5 mg | ≥ 95% | EP11093_5 | 100 EUR | Add to cart |
DescriptionBKV LT-ag peptide LLLIWFRPV (HLA-B*0201) for stimulation of human BKV LT-ag(579-587)-specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allele. LLLIWFRPV is a linear peptidic epitope (epitope ID37507) studied as part of Human polyomavirus 1 (polyomavirus BK) protein from Human polyomavirus 1 (BK polyomavirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay. Allele: A*02:01 Molecular Weight: 1156.49 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BMI1 271–279 (HLA-A*02:01) | CLPSPSTPV | 1 mg | ≥ 95% | EP11099_1 | 50 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 900.07 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BMI1 271–279 (HLA-A*02:01) | CLPSPSTPV | 5 mg | ≥ 95% | EP11099_5 | 100 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 900.07 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BMI1 74-82 (HLA-A*02:01) | TLQDIVYKL | 1 mg | ≥ 95% | EP11100_1 | 50 EUR | Add to cart |
DescriptionTLQDIVYKL is a linear peptidic epitope (epitope ID 459976) studied as part of Polycomb complex protein BMI-1 from Homo sapiens (human) and Polycomb group RING finger protein 2 from Homo sapiens (human). This epitope has been studied for immune reactivity in and was tested in MHC ligand assays. Allele: A*02:01 Molecular Weight: 1092.30 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BMI1 74-82 (HLA-A*02:01) | TLQDIVYKL | 5 mg | ≥ 95% | EP11100_5 | 100 EUR | Add to cart |
DescriptionTLQDIVYKL is a linear peptidic epitope (epitope ID 459976) studied as part of Polycomb complex protein BMI-1 from Homo sapiens (human) and Polycomb group RING finger protein 2 from Homo sapiens (human). This epitope has been studied for immune reactivity in and was tested in MHC ligand assays. Allele: A*02:01 Molecular Weight: 1092.30 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BRAF 594-601 (HLA-B*27:05) (600E) | GRFGLATEK | 1 mg | ≥ 95% | EP11101_1 | 50 EUR | Add to cart |
DescriptionAllele: B*27:05 Molecular Weight: 978.11 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BRAF 594-601 (HLA-B*27:05) (600E) | GRFGLATEK | 5 mg | ≥ 95% | EP11101_5 | 100 EUR | Add to cart |
DescriptionAllele: B*27:05 Molecular Weight: 978.11 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BRAF 594-601 (HLA-B*27:05) (600V) | GRFGLATVK | 1 mg | ≥ 95% | EP11102_1 | 50 EUR | Add to cart |
DescriptionAllele: B*27:05 Molecular Weight: 948.13 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
BRAF 594-601 (HLA-B*27:05) (600V) | GRFGLATVK | 5 mg | ≥ 95% | EP11102_5 | 100 EUR | Add to cart |
DescriptionAllele: B*27:05 Molecular Weight: 948.13 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Carbonic anhydrase 219-227 (HLA-A*24:02) | EYRALQLHL | 1 mg | ≥ 95% | EP11106_1 | 50 EUR | Add to cart |
DescriptionAllele: A*24:02 Molecular Weight: 1142.33 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Carbonic anhydrase 219-227 (HLA-A*24:02) | EYRALQLHL | 5 mg | ≥ 95% | EP11106_5 | 100 EUR | Add to cart |
DescriptionAllele: A*24:02 Molecular Weight: 1142.33 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CB9L2 (HLA-A*02:01) | ALYLMELTM | 1 mg | ≥ 95% | EP11107_1 | 50 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 1084.50 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CB9L2 (HLA-A*02:01) | ALYLMELTM | 5 mg | ≥ 95% | EP11107_5 | 100 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 1084.50 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CD20 188-196 (HLA-A*02:01) | SLFLGILSV | 1 mg | ≥ 95% | EP07888_1 | 50 EUR | Add to cart |
DescriptionSLFLGILSV is a linear peptidic epitope (epitope ID140742) studied as part of B-lymphocyte antigen CD20 from Homo sapiens (human), tested in T cell assays CD20 188-196 (HLA-A*02:01) SLFLGILSV for stimulation of T-cells. Single peptide (SLFLGILSV) for stimulation of human CD20 (188-196)-specific CD8+ T-cells. Allele: A*02:01 other name: MS4A1 188-196 (HLA-A*02:01) Molecular Weight: 948.18 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CD20 188-196 (HLA-A*02:01) | SLFLGILSV | 5 mg | ≥ 95% | EP07888_5 | 100 EUR | Add to cart |
DescriptionSLFLGILSV is a linear peptidic epitope (epitope ID140742) studied as part of B-lymphocyte antigen CD20 from Homo sapiens (human), tested in T cell assays CD20 188-196 (HLA-A*02:01) SLFLGILSV for stimulation of T-cells. Single peptide (SLFLGILSV) for stimulation of human CD20 (188-196)-specific CD8+ T-cells. Allele: A*02:01 other name: MS4A1 188-196 (HLA-A*02:01) Molecular Weight: 948.18 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CD22 antigen (HLA-A*02:01) | PLSEGPHSL | 1 mg | ≥ 95% | EP07885_1 | 50 EUR | Add to cart |
DescriptionAntigen Peptide CD antigen HLA- A*0201 (PLSEGPHSL) for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response Molecular Weight: 936.04 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CD22 antigen (HLA-A*02:01) | PLSEGPHSL | 5 mg | ≥ 95% | EP07885_5 | 100 EUR | Add to cart |
DescriptionAntigen Peptide CD antigen HLA- A*0201 (PLSEGPHSL) for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response Molecular Weight: 936.04 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CD22 antigen 173-181 (HLA-A*02:01) | QLQWLLEGV | 1 mg | ≥ 95% | EP07883_1 | 50 EUR | Add to cart |
DescriptionCD22 antigen(173-181) peptide QLQWLLEGV (HLA- A*0201) for stimulation of T-cells. Single peptide (QLQWLLEGV) for stimulation of human CD22 antigen(173-181)-specific CD8+ T-cells. Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response Molecular Weight: 1085.28 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CD22 antigen 173-181 (HLA-A*02:01) | QLQWLLEGV | 5 mg | ≥ 95% | EP07883_5 | 100 EUR | Add to cart |
DescriptionCD22 antigen(173-181) peptide QLQWLLEGV (HLA- A*0201) for stimulation of T-cells. Single peptide (QLQWLLEGV) for stimulation of human CD22 antigen(173-181)-specific CD8+ T-cells. Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response Molecular Weight: 1085.28 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CD22 antigen 459-467 (HLA-A*02:01) | SLPYHSQKL | 1 mg | ≥ 95% | EP07884_1 | 50 EUR | Add to cart |
DescriptionD22 antigen(459-467) peptide SLPYHSQKL (HLA- A*0201) for stimulation of T-cells. Single peptide (SLPYHSQKL) for stimulation of human CD22 antigen(459-467)-specific CD8+ T-cells. Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response Molecular Weight: 1072.23 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CD22 antigen 459-467 (HLA-A*02:01) | SLPYHSQKL | 5 mg | ≥ 95% | EP07884_5 | 100 EUR | Add to cart |
DescriptionD22 antigen(459-467) peptide SLPYHSQKL (HLA- A*0201) for stimulation of T-cells. Single peptide (SLPYHSQKL) for stimulation of human CD22 antigen(459-467)-specific CD8+ T-cells. Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response Molecular Weight: 1072.23 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CD22-4 371-379 (HLA-A*02:01) | RLLGKESQL | 1 mg | ≥ 95% | EP07909_1 | 50 EUR | Add to cart |
DescriptionSARS-CoV-2 peptide LLLDRLNQL (HLA-A*0201) for stimulation of T-cells. Single peptide (LLLDRLNQL) for stimulation of human SARS-CoV-2-specific CD8+ T-cells. Molecular Weight: 1097.33 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CD22-4 371-379 (HLA-A*02:01) | RLLGKESQL | 5 mg | ≥ 95% | EP07909_5 | 100 EUR | Add to cart |
DescriptionSARS-CoV-2 peptide LLLDRLNQL (HLA-A*0201) for stimulation of T-cells. Single peptide (LLLDRLNQL) for stimulation of human SARS-CoV-2-specific CD8+ T-cells. Molecular Weight: 1097.33 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CD33 65-73 (HLA-A*02:01) (65Y66L) | YLISGDSPV | 1 mg | ≥ 95% | EP11108_1 | 50 EUR | Add to cart |
DescriptionYLISGDSPV is a linear peptidic epitope (epitope ID74719), tested in T cell assays and MHC ligand assay Allele: A*02:01 Molecular Weight: 950.07 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CD33 65-73 (HLA-A*02:01) (65Y66L) | YLISGDSPV | 5 mg | ≥ 95% | EP11108_5 | 100 EUR | Add to cart |
DescriptionYLISGDSPV is a linear peptidic epitope (epitope ID74719), tested in T cell assays and MHC ligand assay Allele: A*02:01 Molecular Weight: 950.07 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CD59 glycoprotein precursor 106-114 (HLA-A*02:01) | SLSEKTVLL | 1 mg | ≥ 95% | EP11109_1 | 50 EUR | Add to cart |
DescriptionSLSEKTVLL is a linear peptidic epitope (epitope ID 59453) studied as part of CD59 glycoprotein from Homo sapiens (human). This epitope has been studied for immune reactivity and was tested in T cell assay as well as MHC ligand assays Allele: A*02:01 Molecular Weight: 989.18 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CD59 glycoprotein precursor 106-114 (HLA-A*02:01) | SLSEKTVLL | 5 mg | ≥ 95% | EP11109_5 | 100 EUR | Add to cart |
DescriptionSLSEKTVLL is a linear peptidic epitope (epitope ID 59453) studied as part of CD59 glycoprotein from Homo sapiens (human). This epitope has been studied for immune reactivity and was tested in T cell assay as well as MHC ligand assays Allele: A*02:01 Molecular Weight: 989.18 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CD79b 52-60 (HLA-A*02:01) | TLKDGIIMI | 1 mg | ≥ 95% | EP07910_1 | 50 EUR | Add to cart |
DescriptionAntigen Peptide CD antigen HLA-A*0203 (TLKDGIIMI) for stimulation of antigen-specific T cells in T cell assays Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response Molecular Weight: 1003.27 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CD79b 52-60 (HLA-A*02:01) | TLKDGIIMI | 5 mg | ≥ 95% | EP07910_5 | 100 EUR | Add to cart |
DescriptionAntigen Peptide CD antigen HLA-A*0203 (TLKDGIIMI) for stimulation of antigen-specific T cells in T cell assays Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response Molecular Weight: 1003.27 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CDH3 807-816 (HLA-A*24:02) | DYLNEWGSRF | 1 mg | ≥ 95% | EP11377_1 | 50 EUR | Add to cart |
DescriptionYLNEWGSRF is a linear peptidic epitope (epitope ID477138) studied as part of Cadherin-3 from Homo sapiens (human), tested in MHC ligand assays Allele: A*24:02 other name: p-Cadherin 807-816 (HLA-A*24:02) Molecular Weight: 1171.29 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CDH3 807-816 (HLA-A*24:02) | DYLNEWGSRF | 5 mg | ≥ 95% | EP11377_5 | 100 EUR | Add to cart |
DescriptionYLNEWGSRF is a linear peptidic epitope (epitope ID477138) studied as part of Cadherin-3 from Homo sapiens (human), tested in MHC ligand assays Allele: A*24:02 other name: p-Cadherin 807-816 (HLA-A*24:02) Molecular Weight: 1171.29 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CEA 605-613 (HLA-A*02:01) | YLSGANLNL | 1 mg | ≥ 95% | EP07878_1 | 50 EUR | Add to cart |
DescriptionYLSGANLNL is a linear peptidic epitope (epitope ID74915) studied as part of Carcinoembryonic antigen-related cell adhesion molecule 5 from Homo sapiens (human) and Protein X from Hepatitis B virus (Human hepatitis B virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays. Allele: A*02:01 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CEA 605-613 (HLA-A*02:01) | YLSGANLNL | 5 mg | ≥ 95% | EP07878_5 | 100 EUR | Add to cart |
DescriptionYLSGANLNL is a linear peptidic epitope (epitope ID74915) studied as part of Carcinoembryonic antigen-related cell adhesion molecule 5 from Homo sapiens (human) and Protein X from Hepatitis B virus (Human hepatitis B virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays. Allele: A*02:01 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CEA 605-613 mutant (HLA-A*02:01) 610D | YLSGADLNL | 1 mg | ≥ 95% | EP11112_1 | 50 EUR | Add to cart |
Descriptionother name: Carcinoembryonic antigen (CEA)-derived peptide CEA-610D Allele: A*02:01 Molecular Weight: 965.08 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CEA 605-613 mutant (HLA-A*02:01) 610D | YLSGADLNL | 5 mg | ≥ 95% | EP11112_5 | 100 EUR | Add to cart |
Descriptionother name: Carcinoembryonic antigen (CEA)-derived peptide CEA-610D Allele: A*02:01 Molecular Weight: 965.08 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CEA 652-660 (HLA-A*24:02) | TYACFVSNL | 1 mg | ≥ 95% | EP11111_1 | 50 EUR | Add to cart |
DescriptionCarcinogenic Embryonic Antigen (CEA) 652-660 is a linear peptidic epitope (epitope ID 67308) studied as part of Carcinoembryonic antigen-related cell adhesion molecule 5 from Homo sapiens (human). This epitope has been studied for immune reactivity snd was tested in T cell assays as well as MHC ligand assay Allele: A*24:02 Molecular Formula: C46H68N10O14S Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CEA 652-660 (HLA-A*24:02) | TYACFVSNL | 5 mg | ≥ 95% | EP11111_5 | 100 EUR | Add to cart |
DescriptionCarcinogenic Embryonic Antigen (CEA) 652-660 is a linear peptidic epitope (epitope ID 67308) studied as part of Carcinoembryonic antigen-related cell adhesion molecule 5 from Homo sapiens (human). This epitope has been studied for immune reactivity snd was tested in T cell assays as well as MHC ligand assay Allele: A*24:02 Molecular Formula: C46H68N10O14S Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CEA 694-702 (HLA-A*02:01) | GVLVGVALI | 1 mg | ≥ 95% | EP11110_1 | 50 EUR | Add to cart |
DescriptionGVLVGVALI is a linear peptidic epitope (epitope ID137754) studied as part of Carcinoembryonic antigen-related cell adhesion molecule 5 from Homo sapiens (human)., tested in T cell assay Allele: A*02:01 other name: Carcinogenic Embryonic Antigen (694-702) Molecular Weight: 840.08 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CEA 694-702 (HLA-A*02:01) | GVLVGVALI | 5 mg | ≥ 95% | EP11110_5 | 100 EUR | Add to cart |
DescriptionGVLVGVALI is a linear peptidic epitope (epitope ID137754) studied as part of Carcinoembryonic antigen-related cell adhesion molecule 5 from Homo sapiens (human)., tested in T cell assay Allele: A*02:01 other name: Carcinogenic Embryonic Antigen (694-702) Molecular Weight: 840.08 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CEACAM 185-193 (HLA-B*07:02) | LPVSPRLQL | 1 mg | ≥ 95% | EP11113_1 | 50 EUR | Add to cart |
DescriptionAllele: B*07:02 Molecular Weight: 1022.27 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CEACAM 185-193 (HLA-B*07:02) | LPVSPRLQL | 5 mg | ≥ 95% | EP11113_5 | 100 EUR | Add to cart |
DescriptionAllele: B*07:02 Molecular Weight: 1022.27 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Cecropin A (1-7)-Melittin A (2-9) | KWKLFKKIGAVLKVL-NH2 | 1 mg | ≥95% | EP14421_1 | 50 EUR | Add to cart |
DescriptionCecropin A (1-7)-Melittin A (2-9) amide, also referred to as CAMEL0, is a synthetic hybrid peptide that is composed of portions of the naturally occurring antibiotic peptide cecropin A and melittin. CAMEL0 shows a better antimicrobial activity than the native molecules, but lacks the hemolytic properties of melittin. Studies revealed that the range of its antimicrobial activity is not only restricted to aerobic microorganisms but also included several gram-negative and gram-positive anaerobic microorganisms. Through its ascertained broad spectrum of antibiotic activity, this hybrid peptide may also represent an effective substitute for ciprofloxacin in the treatment of anthrax infections. KWKLFKKIGAVLKVL obtained by combining residues 1-7 of cecropin and residues 2-9 of melittin, it is an antimicrobial peptide other name: CM15, CAMEL0, Cecropin A (1-8)-Melittin A (3-9) amide, Cecropin A-melittin hybrid peptide [CA(1-7)M(2-9)NH2] Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Cecropin A (1-7)-Melittin A (2-9) | KWKLFKKIGAVLKVL-NH2 | 5 mg | ≥95% | EP14421_5 | 150 EUR | Add to cart |
DescriptionCecropin A (1-7)-Melittin A (2-9) amide, also referred to as CAMEL0, is a synthetic hybrid peptide that is composed of portions of the naturally occurring antibiotic peptide cecropin A and melittin. CAMEL0 shows a better antimicrobial activity than the native molecules, but lacks the hemolytic properties of melittin. Studies revealed that the range of its antimicrobial activity is not only restricted to aerobic microorganisms but also included several gram-negative and gram-positive anaerobic microorganisms. Through its ascertained broad spectrum of antibiotic activity, this hybrid peptide may also represent an effective substitute for ciprofloxacin in the treatment of anthrax infections. KWKLFKKIGAVLKVL obtained by combining residues 1-7 of cecropin and residues 2-9 of melittin, it is an antimicrobial peptide other name: CM15, CAMEL0, Cecropin A (1-8)-Melittin A (3-9) amide, Cecropin A-melittin hybrid peptide [CA(1-7)M(2-9)NH2] Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Chlamydia trachomatis MOMP 258-266 (HLA-A*02:01) | RLNMFTPYI | 1 mg | ≥ 95% | EP11114_1 | 50 EUR | Add to cart |
DescriptionRLNMFTPYI is a linear peptidic epitope (epitope ID54686) studied as part of Chlamydia trachomatis and Major outer membrane porin, serovar D from Chlamydia trachomatis. This epitope has been studied for immune reactivity in publication(s), tested in T cell assays and MHC ligand assay Allele: A*02:01 Molecular Weight: 1154.41 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Chlamydia trachomatis MOMP 258-266 (HLA-A*02:01) | RLNMFTPYI | 5 mg | ≥ 95% | EP11114_5 | 100 EUR | Add to cart |
DescriptionRLNMFTPYI is a linear peptidic epitope (epitope ID54686) studied as part of Chlamydia trachomatis and Major outer membrane porin, serovar D from Chlamydia trachomatis. This epitope has been studied for immune reactivity in publication(s), tested in T cell assays and MHC ligand assay Allele: A*02:01 Molecular Weight: 1154.41 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Chondromodulin-I 319-327 (HLA-A*02:01) | VIMPCSWWV | 1 mg | ≥ 95% | EP11115_1 | 50 EUR | Add to cart |
DescriptionMolecular Weight: 1120.41 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Chondromodulin-I 319-327 (HLA-A*02:01) | VIMPCSWWV | 5 mg | ≥ 95% | EP11115_5 | 100 EUR | Add to cart |
DescriptionMolecular Weight: 1120.41 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CKS2 11-19 (HLA-C0702) | KYFDEHYEY | 1 mg | ≥95% | EP13049_1 | 50 EUR | Add to cart |
DescriptionKYFDEHYEY is a linear peptidic epitope studied as part of Cyclin-dependent kinases regulatory subunit 2 from Homo sapiens (human) and Other Mus musculus (mouse) protein from Mus musculus (mouse). This epitope has been studied for immune reactivity, tested in MHC ligand assays. Molecular Weight: 1293.36 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CKS2 11-19 (HLA-C0702) | KYFDEHYEY | 5 mg | ≥95% | EP13049_5 | 100 EUR | Add to cart |
DescriptionKYFDEHYEY is a linear peptidic epitope studied as part of Cyclin-dependent kinases regulatory subunit 2 from Homo sapiens (human) and Other Mus musculus (mouse) protein from Mus musculus (mouse). This epitope has been studied for immune reactivity, tested in MHC ligand assays. Molecular Weight: 1293.36 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV IE-1 199-207 (HLA-B*08:01) | ELRRKMMYM | 1 mg | ≥ 95% | EP11120_1 | 50 EUR | Add to cart |
DescriptionELRRKMMYM is a linear peptidic epitope (epitope ID 13133) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivit, tested in Tcell assays and MHC ligand assays. Allele: B*08:01 Molecular Weight: 1257.61 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV IE-1 199-207 (HLA-B*08:01) | ELRRKMMYM | 5 mg | ≥ 95% | EP11120_5 | 100 EUR | Add to cart |
DescriptionELRRKMMYM is a linear peptidic epitope (epitope ID 13133) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivit, tested in Tcell assays and MHC ligand assays. Allele: B*08:01 Molecular Weight: 1257.61 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV IE-1 199-207 mutant (HLA-B*08:01) 201K, 205I | ELKRKMIYM | 1 mg | ≥ 95% | EP11118_1 | 50 EUR | Add to cart |
DescriptionELKRKMIYM is a linear peptidic epitope (epitope ID 13133) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in Tcell assays and MHC ligand assays. Allele: B*08:01 Molecular Weight: 1211.55 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV IE-1 199-207 mutant (HLA-B*08:01) 201K, 205I | ELKRKMIYM | 5 mg | ≥ 95% | EP11118_5 | 100 EUR | Add to cart |
DescriptionELKRKMIYM is a linear peptidic epitope (epitope ID 13133) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in Tcell assays and MHC ligand assays. Allele: B*08:01 Molecular Weight: 1211.55 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV IE-1 248-256 (HLA-A*24:02) | AYAQKIFKI | 1 mg | ≥ 95% | EP11117_1 | 50 EUR | Add to cart |
DescriptionAYAQKIFKI is a linear peptidic epitope (epitope ID140986) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry Molecular Weight: 1081.32 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV IE-1 248-256 (HLA-A*24:02) | AYAQKIFKI | 5 mg | ≥ 95% | EP11117_5 | 100 EUR | Add to cart |
DescriptionAYAQKIFKI is a linear peptidic epitope (epitope ID140986) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry Molecular Weight: 1081.32 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV IE-1 378-389 (HLA-B18) | SDEEEAIVAYTL | 1 mg | ≥95% | EP08624_1 | 80 EUR | Add to cart |
DescriptionHLA-B18-restricted epitope from Cytomegalovirus (378-389) other name: CEF24, Cytomegalovirus 378-389 Molecular Weight: 1339.43 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV IE-1 378-389 (HLA-B18) | SDEEEAIVAYTL | 5 mg | ≥95% | EP08624_5 | 160 EUR | Add to cart |
DescriptionHLA-B18-restricted epitope from Cytomegalovirus (378-389) other name: CEF24, Cytomegalovirus 378-389 Molecular Weight: 1339.43 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV IE1 51-59 (HLA-B*08:01) | ELNRKMIYM | 1 mg | ≥ 95% | EP11119_1 | 50 EUR | Add to cart |
DescriptionCMV IE1-derived peptide of ELNRKMIYM covering 51-59 and B*08:01 molecule is a linear peptidic epitope (epitope ID 240792) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus), tested in T cell assays and MHC ligand assays. Allele: B*08:01 Molecular Weight: 1197.49 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV IE1 51-59 (HLA-B*08:01) | ELNRKMIYM | 5 mg | ≥ 95% | EP11119_5 | 100 EUR | Add to cart |
DescriptionCMV IE1-derived peptide of ELNRKMIYM covering 51-59 and B*08:01 molecule is a linear peptidic epitope (epitope ID 240792) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus), tested in T cell assays and MHC ligand assays. Allele: B*08:01 Molecular Weight: 1197.49 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV pp50 245-253 (HLA-A*01:01) | VTEHDTLLY | 1 mg | ≥ 95% | EP05819_1 | 50 EUR | Add to cart |
DescriptionVTEHDTLLY is a linear peptidic epitope (epitope ID71290) studied as part of DNA polymerase processivity factor from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay Allele: B*01:01 Molecular Weight: 1090.21 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV pp50 245-253 (HLA-A*01:01) | VTEHDTLLY | 5 mg | ≥ 95% | EP05819_5 | 100 EUR | Add to cart |
DescriptionVTEHDTLLY is a linear peptidic epitope (epitope ID71290) studied as part of DNA polymerase processivity factor from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay Allele: B*01:01 Molecular Weight: 1090.21 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV pp65 (HLA-C*04:01) | QYDPVAALFL | 1 mg | ≥ 95% | EP07966_1 | 50 EUR | Add to cart |
DescriptionMolecular Weight: 1136.32 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV pp65 (HLA-C*04:01) | QYDPVAALFL | 5 mg | ≥ 95% | EP07966_5 | 100 EUR | Add to cart |
DescriptionMolecular Weight: 1136.32 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV pp65 16-24 (HLA-A*11:01) | GPISGHVLK | 1 mg | ≥ 95% | EP06165_1 | 50 EUR | Add to cart |
DescriptionCMV pp65(16-24) peptide GPISGHVLK (HLA-A*1101) for stimulation of human CMV pp65 (16-24)-specific CD8+ T-cells. Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response Molecular Weight: 907.08 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV pp65 16-24 (HLA-A*11:01) | GPISGHVLK | 5 mg | ≥ 95% | EP06165_5 | 100 EUR | Add to cart |
DescriptionCMV pp65(16-24) peptide GPISGHVLK (HLA-A*1101) for stimulation of human CMV pp65 (16-24)-specific CD8+ T-cells. Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response Molecular Weight: 907.08 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV pp65 265-275 (HLA-B*07:02) | RPHERNGFTVL | 1 mg | ≥ 95% | EP07911_1 | 50 EUR | Add to cart |
DescriptionRPHERNGFTVL is a linear peptidic epitope (epitope ID55170) studied as part of 65 kDa phosphoprotein from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Allele: B*07:02 Molecular Weight: 1325.50 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free
|
||||||
CMV pp65 265-275 (HLA-B*07:02) | RPHERNGFTVL | 5 mg | ≥ 95% | EP07911_5 | 100 EUR | Add to cart |
DescriptionRPHERNGFTVL is a linear peptidic epitope (epitope ID55170) studied as part of 65 kDa phosphoprotein from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Allele: B*07:02 Molecular Weight: 1325.50 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV pp65 417 – 426 (HLA-B*07:02) | TPRVTGGGAM | 1 mg | ≥ 95% | EP05818_1 | 100 EUR | Add to cart |
DescriptionAntigen Peptide CMV pp65 417 – 426 (HLA-B*07:02) TPRVTGGGAM for stimulation of antigen-specific T cells in T cell assays TPRVTGGGAM is a linear peptidic epitope (epitope ID65748) studied as part of 65 kDa phosphoprotein from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Allele: B*07:02 Molecular Weight: 946.10 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV pp65 417 – 426 (HLA-B*07:02) | TPRVTGGGAM | 5 mg | ≥ 95% | EP05818_5 | 170 EUR | Add to cart |
DescriptionAntigen Peptide CMV pp65 417 – 426 (HLA-B*07:02) TPRVTGGGAM for stimulation of antigen-specific T cells in T cell assays TPRVTGGGAM is a linear peptidic epitope (epitope ID65748) studied as part of 65 kDa phosphoprotein from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Allele: B*07:02 Molecular Weight: 946.10 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV pp65 417-426 (HLA-B*07:02), amide | TPRVTGGGAM-NH2 | 1 mg | ≥95% | EP01897_1 | 100 EUR | Add to cart |
DescriptionMolecular Weight: 945.09
Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV pp65 417-426 (HLA-B*07:02), amide | TPRVTGGGAM-NH2 | 5 mg | ≥95% | EP01897_5 | 170 EUR | Add to cart |
DescriptionMolecular Weight: 945.09 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV pp65 495-503 (HLA-A*02:01) | NLVPMVATV | 1 mg | ≥ 95% | EP04509_1 | 50 EUR | Add to cart |
DescriptionNLVPMVATV is a linear peptidic epitope (epitope ID44920) studied as part of 65 kDa phosphoprotein from Human herpesvirus 5 (Human cytomegalovirus) and Unidentified protein from Unidentified. This epitope has been studied for immune reactivity, tested in T cell assays, B cell assays and MHC ligand assays Allele: A*02:01 Molecular Weight: 943.18 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV pp65 495-503 (HLA-A*02:01) | NLVPMVATV | 5 mg | ≥ 95% | EP04509_5 | 100 EUR | Add to cart |
DescriptionNLVPMVATV is a linear peptidic epitope (epitope ID44920) studied as part of 65 kDa phosphoprotein from Human herpesvirus 5 (Human cytomegalovirus) and Unidentified protein from Unidentified. This epitope has been studied for immune reactivity, tested in T cell assays, B cell assays and MHC ligand assays Allele: A*02:01 Molecular Weight: 943.18 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV UL138 (HLA-B*35:01) | LPLNVGLPIIGVM | 1 mg | ≥ 95% | EP11123_1 | 100 EUR | Add to cart |
DescriptionLPLNVGLPIIGVM is a linear peptidic epitope (epitope ID 188912) studied as part of Protein UL138 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry Molecular Weight: 1335.73 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV UL138 (HLA-B*35:01) | LPLNVGLPIIGVM | 5 mg | ≥ 95% | EP11123_5 | 200 EUR | Add to cart |
DescriptionLPLNVGLPIIGVM is a linear peptidic epitope (epitope ID 188912) studied as part of Protein UL138 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry Molecular Weight: 1335.73 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV UL40 15-23 (HLA-E) | VMAPRTLIL | 1 mg | ≥ 95% | EP06244_1 | 50 EUR | Add to cart |
DescriptionVMAPRTLIL is a linear peptidic epitope (epitope ID69921) studied as part of HLA class I histocompatibility antigen, Cw-14 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-5 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-2 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-4 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-3 alpha chain from Homo sapiens (human), Protein UL40 from Human herpesvirus 5 (Human cytomegalovirus), HLA class I histocompatibility antigen, Cw-8 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-12 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-16 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-17 alpha chain from Homo sapiens (human) and Unidentified protein from Unidentified. This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Allele: HLA-E Molecular Weight: 1013.32 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CMV UL40 15-23 (HLA-E) | VMAPRTLIL | 5 mg | ≥ 95% | EP06244_5 | 100 EUR | Add to cart |
DescriptionVMAPRTLIL is a linear peptidic epitope (epitope ID69921) studied as part of HLA class I histocompatibility antigen, Cw-14 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-5 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-2 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-4 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-3 alpha chain from Homo sapiens (human), Protein UL40 from Human herpesvirus 5 (Human cytomegalovirus), HLA class I histocompatibility antigen, Cw-8 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-12 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-16 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-17 alpha chain from Homo sapiens (human) and Unidentified protein from Unidentified. This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Allele: HLA-E Molecular Weight: 1013.32 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CPIM 399–406 (H-2 Kb) | HILIYSDV | 1 mg | ≥95% | EP13089_1 | 50 EUR | Add to cart |
DescriptionHILIYSDV is a linear peptidic epitope studied as part of Myosin-binding protein C, fast-type from Mus musculus (mouse), tested in T cell assay and MHC ligand assay. Allele: H-2Kb Molecular Weight: 959.12 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CPIM 399–406 (H-2 Kb) | HILIYSDV | 5 mg | ≥95% | EP13089_5 | 100 EUR | Add to cart |
DescriptionHILIYSDV is a linear peptidic epitope studied as part of Myosin-binding protein C, fast-type from Mus musculus (mouse), tested in T cell assay and MHC ligand assay. Allele: H-2Kb Molecular Weight: 959.12 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CRGDS | CRGDS | 1 mg | ≥ 95% | EP08010_1 | 50 EUR | Add to cart |
DescriptionGRGDS forms the cell-binding domain of a glycoprotein, Osteopontin (OPN) . Although the native form of OPN is active in cell attachment assays, it has been observed that thrombin cleavage of OPN causes substantial enhancement of it's attachment properties. This cleavage occurs within residues of the GRGDS sequence raising the possibility of thrombin-cleavage further activating OPN by allowing greater accessibility of the GRGDS domain to cell surface receptors. GRGDS synthetic peptide also mimics the cellular binding site of many adhesive proteins in the extracellular matrix and causes rounding and detachment of spread cells. It induces dissociation of alpha-actinin and vinculin from the sites of focal contacts. Gly-Arg-Gly-Asp-Ser peptide sequence is identical to the cell-binding region of fibronectin protein. Arg-Gly-Asp (RGD) region is found in various proteins, and is crucial for facilitating cell-adhesive activity. Molecular Weight: 490.48 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CRGDS | CRGDS | 5 mg | ≥ 95% | EP08010_5 | 100 EUR | Add to cart |
DescriptionGRGDS forms the cell-binding domain of a glycoprotein, Osteopontin (OPN) . Although the native form of OPN is active in cell attachment assays, it has been observed that thrombin cleavage of OPN causes substantial enhancement of it's attachment properties. This cleavage occurs within residues of the GRGDS sequence raising the possibility of thrombin-cleavage further activating OPN by allowing greater accessibility of the GRGDS domain to cell surface receptors. GRGDS synthetic peptide also mimics the cellular binding site of many adhesive proteins in the extracellular matrix and causes rounding and detachment of spread cells. It induces dissociation of alpha-actinin and vinculin from the sites of focal contacts. Gly-Arg-Gly-Asp-Ser peptide sequence is identical to the cell-binding region of fibronectin protein. Arg-Gly-Asp (RGD) region is found in various proteins, and is crucial for facilitating cell-adhesive activity. Molecular Weight: 490.48 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Cyclin A1 227-235 (HLA-A*02:01) | FLDRFLSCM | 1 mg | ≥ 95% | EP07912_1 | 50 EUR | Add to cart |
DescriptionSingle peptide (FLDRFLSCM) for stimulation of human CyclinA1(227-235)-specific CD8+T cells Molecular Weight: 1131.39 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Cyclin A1 227-235 (HLA-A*02:01) | FLDRFLSCM | 5 mg | ≥ 95% | EP07912_5 | 100 EUR | Add to cart |
DescriptionSingle peptide (FLDRFLSCM) for stimulation of human CyclinA1(227-235)-specific CD8+T cells Molecular Weight: 1131.39 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
CyLoP-1 | CRWRWKCCKK | 1 mg | ≥ 95% | EP09848_1 | 120 EUR | Add to cart |
DescriptionCyLoP-1 is a cysteine-rich cell-penetrating peptide derived from nuclear localization sequence of snake toxin, crotamine. The peptide has shown cytoplasmic uptake in mammalian cells at lower concentrations. In the present study, the cell-penetrating and antimicrobial activity of the peptide has been studied by employing mammalian cells, plant cells as well as bacterial and fungal pathogens. The study shows that the peptide acts as an effective CPP and a cargo-delivery vector for not only mammalian cells but also for plant cells. Besides this, the peptide also possesses antimicrobial activity against representative pathogens tested. It is shown to be effective in killing methicillin-resistant Staphylococcus aureus. We have observed that the presence of cysteine residues in the peptide play a major role in conferring cell-penetrating as well as antimicrobial activity to the peptide since there is a significant decline in these activities when cysteine residues are replaced with serine residues. Our findings are significant for the proposition that CyLoP-1 is an efficient membrane-active peptide with both cell-penetrating and antimicrobial activity. Hence, it can be further evaluated for its application in the field of drug-delivery, plant biotechnology and as a peptide-antibiotic. Molecular Weight: 1396.76 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free
|
||||||
CyLoP-1 | CRWRWKCCKK | 5 mg | ≥ 95% | EP09848_5 | 150 EUR | Add to cart |
DescriptionCyLoP-1 is a cysteine-rich cell-penetrating peptide derived from nuclear localization sequence of snake toxin, crotamine. The peptide has shown cytoplasmic uptake in mammalian cells at lower concentrations. In the present study, the cell-penetrating and antimicrobial activity of the peptide has been studied by employing mammalian cells, plant cells as well as bacterial and fungal pathogens. The study shows that the peptide acts as an effective CPP and a cargo-delivery vector for not only mammalian cells but also for plant cells. Besides this, the peptide also possesses antimicrobial activity against representative pathogens tested. It is shown to be effective in killing methicillin-resistant Staphylococcus aureus. We have observed that the presence of cysteine residues in the peptide play a major role in conferring cell-penetrating as well as antimicrobial activity to the peptide since there is a significant decline in these activities when cysteine residues are replaced with serine residues. Our findings are significant for the proposition that CyLoP-1 is an efficient membrane-active peptide with both cell-penetrating and antimicrobial activity. Hence, it can be further evaluated for its application in the field of drug-delivery, plant biotechnology and as a peptide-antibiotic. Molecular Weight: 1396.76 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Cytochrome p450 1B1 239-248 (HLA-A*02:01) | SLVDVMPWL | 1 mg | ≥ 95% | EP11124_1 | 50 EUR | Add to cart |
DescriptionMolecular Weight: 1059.30 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Cytochrome p450 1B1 239-248 (HLA-A*02:01) | SLVDVMPWL | 5 mg | ≥ 95% | EP11124_5 | 100 EUR | Add to cart |
DescriptionMolecular Weight: 1059.30 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
DEAD box RNA helicase (355–363) HLA-C*05:01 | ITASRFKEL | 1 mg | ≥ 95% | EP14505_1 | 50 EUR | Add to cart |
DescriptionMolecular Weight: 1064.25 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
DEAD box RNA helicase (355–363) HLA-C*05:01 | ITASRFKEL | 5 mg | ≥ 95% | EP14505_5 | 100 EUR | Add to cart |
DescriptionMolecular Weight: 1064.25 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
DEP DC1 294-302 (HLA-A*24:02) | EYYELFVNI | 1 mg | ≥ 95% | EP11125_1 | 50 EUR | Add to cart |
DescriptionAllele: A*24:02 Molecular Weight: 1189.34 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free
|
||||||
DEP DC1 294-302 (HLA-A*24:02) | EYYELFVNI | 5 mg | ≥ 95% | EP11125_5 | 100 EUR | Add to cart |
DescriptionAllele: A*24:02 Molecular Weight: 1189.34 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Derp1 117–127 | CQIYPPNVNKI | 1 mg | 95% | EP11647_1 | 80 EUR | Add to cart |
DescriptionCQIYPPNVNKI is a linear peptidic epitope (epitope ID242387) studied as part of Der p 1 from Dermatophagoides pteronyssinus (European house dust mite), tested in T cell assays antigen name: Derp1 Molecular Weight: 1288.54 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
Derp1 117–127 | CQIYPPNVNKI | 5 mg | 95% | EP11647_5 | 160 EUR | Add to cart |
DescriptionCQIYPPNVNKI is a linear peptidic epitope (epitope ID242387) studied as part of Der p 1 from Dermatophagoides pteronyssinus (European house dust mite), tested in T cell assays antigen name: Derp1 Molecular Weight: 1288.54 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
DLK1 309-317 (HLA-A*02:01) | ILGVLTSLV | 1 mg | ≥ 95% | EP11126_1 | 50 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 914.16 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
DLK1 309-317 (HLA-A*02:01) | ILGVLTSLV | 5 mg | ≥ 95% | EP11126_5 | 100 EUR | Add to cart |
DescriptionAllele: A*02:01 Molecular Weight: 914.16 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBNA 3a (596-604) | SVRDRLARL | 1 mg | ≥ 95% | EP10789_1 | 50 EUR | Add to cart |
DescriptionThis peptide represents an HLA-A2-restricted epitope of the Epstein-Barr virus nuclear antigen 3 (EBNA 3). EBNA 3 is a transcriptional regulatory protein that promotes B cell activation through the RBP-Jk pathway. This peptide is used in the study of immunotherapy for solid organ transplant patients. Molecular Weight: 1085.28 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBNA 3a (596-604) | SVRDRLARL | 5 mg | ≥ 95% | EP10789_5 | 100 EUR | Add to cart |
DescriptionThis peptide represents an HLA-A2-restricted epitope of the Epstein-Barr virus nuclear antigen 3 (EBNA 3). EBNA 3 is a transcriptional regulatory protein that promotes B cell activation through the RBP-Jk pathway. This peptide is used in the study of immunotherapy for solid organ transplant patients. Molecular Weight: 1085.28 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBNA-1 Protein (562-570) | FMVFLQTHI | 1 mg | ≥95% | EP04510_1 | 50 EUR | Add to cart |
DescriptionThe Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalo virus). On infecting the B-lymphocyte, the linear virus genome circularizes and the virus subsequently persists within the cell as an episome. The virus can execute several distinct programs of gene expression which can be broadly categorized as being lytic cycle or latent cycle. The lytic cycle or productive infection results in staged expression of a host of viral proteins with the ultimate objective of producing infectious virions. Formally, this phase of infection does not inevitably lead to lysis of the host cell as EBV virions are produced by budding from the infected cell. The latent cycle (lysogenic) programs are those that do not result in production of virions. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBNA-1 Protein (562-570) | FMVFLQTHI | 5 mg | ≥95% | EP04510_5 | 100 EUR | Add to cart |
DescriptionThe Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalo virus). On infecting the B-lymphocyte, the linear virus genome circularizes and the virus subsequently persists within the cell as an episome. The virus can execute several distinct programs of gene expression which can be broadly categorized as being lytic cycle or latent cycle. The lytic cycle or productive infection results in staged expression of a host of viral proteins with the ultimate objective of producing infectious virions. Formally, this phase of infection does not inevitably lead to lysis of the host cell as EBV virions are produced by budding from the infected cell. The latent cycle (lysogenic) programs are those that do not result in production of virions. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BALF-4 276–284 (HLA-A*02:01) | FLDKGTYTL | 1 mg | ≥ 95% | EP11237_1 | 50 EUR | Add to cart |
DescriptionFLDKGTYTL is a linear peptidic epitope (epitope ID16548) studied as part of Envelope glycoprotein B from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Antigen Peptide EBV BALF-4 276–284 (HLA-A*02:01) FLDKGTYTL for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BALF-4 276–284 (HLA-A*02:01) | FLDKGTYTL | 5 mg | ≥ 95% | EP11237_5 | 100 EUR | Add to cart |
DescriptionFLDKGTYTL is a linear peptidic epitope (epitope ID16548) studied as part of Envelope glycoprotein B from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Antigen Peptide EBV BALF-4 276–284 (HLA-A*02:01) FLDKGTYTL for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BMLF-1 280-288 (HLA-A*02:01) | GLCTLVAML | 1 mg | ≥ 95% | EP07604_1 | 50 EUR | Add to cart |
DescriptionEBV peptide GLCTLVAML (HLA-A*0201) for stimulation of T-cells. Single peptide (GLCTLVAML) for stimulation of human EBV BMLF-1(280-288) CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allele. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BMLF-1 280-288 (HLA-A*02:01) | GLCTLVAML | 5 mg | ≥ 95% | EP07604_5 | 100 EUR | Add to cart |
DescriptionEBV peptide GLCTLVAML (HLA-A*0201) for stimulation of T-cells. Single peptide (GLCTLVAML) for stimulation of human EBV BMLF-1(280-288) CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allele. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BMRF1 116-128 (HLA-B*07:02) | RPQGGSRPEFVKL | 1 mg | ≥ 95% | EP11138_1 | 100 EUR | Add to cart |
DescriptionRPQGGSRPEFVKL is a linear peptidic epitope (epitope ID 55295) studied as part of DNA polymerase processivity factor BMRF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity and tested in T cell assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BMRF1 116-128 (HLA-B*07:02) | RPQGGSRPEFVKL | 5 mg | ≥ 95% | EP11138_5 | 200 EUR | Add to cart |
DescriptionRPQGGSRPEFVKL is a linear peptidic epitope (epitope ID 55295) studied as part of DNA polymerase processivity factor BMRF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity and tested in T cell assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BMRF1 208-216 (HLA-A*02:01) | TLDYKPLSV | 1 mg | ≥ 95% | EP11127_1 | 50 EUR | Add to cart |
DescriptionTLDYKPLSV is a linear peptidic epitope (epitope ID 64763) studied as part of DNA polymerase processivity factor BMRF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BMRF1 208-216 (HLA-A*02:01) | TLDYKPLSV | 5 mg | ≥ 95% | EP11127_5 | 100 EUR | Add to cart |
DescriptionTLDYKPLSV is a linear peptidic epitope (epitope ID 64763) studied as part of DNA polymerase processivity factor BMRF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BRLF-1 148-156 (HLA-A*03:01) | RVRAYTYSK | 1 mg | ≥ 95% | EP11482_1 | 50 EUR | Add to cart |
DescriptionHLA-A∗0301-restricted epitope from Epstein-Barr Virus , EBV BRLF-1 (148-156). RVRAYTYSK is a linear peptidic epitope (epitope ID56390) studied as part of Replication and transcription activator from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays other name: CEF27, Epstein – Barr Virus BRLF – 1 lytic (148 – 156) Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BRLF-1 148-156 (HLA-A*03:01) | RVRAYTYSK | 5 mg | ≥ 95% | EP11482_5 | 100 EUR | Add to cart |
DescriptionHLA-A∗0301-restricted epitope from Epstein-Barr Virus , EBV BRLF-1 (148-156). RVRAYTYSK is a linear peptidic epitope (epitope ID56390) studied as part of Replication and transcription activator from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays other name: CEF27, Epstein – Barr Virus BRLF – 1 lytic (148 – 156) Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BRLF1 101-109 (HLA-A*29:02) | IACPIVMRY | 1 mg | ≥ 95% | EP11142_1 | 50 EUR | Add to cart |
DescriptionDelivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BRLF1 101-109 (HLA-A*29:02) | IACPIVMRY | 5 mg | ≥ 95% | EP11142_5 | 100 EUR | Add to cart |
DescriptionDelivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BRLF1 109–117 (HLA-A*02:01) | YVLDHLIVV | 1 mg | ≥ 95% | EP11139_1 | 50 EUR | Add to cart |
DescriptionAntigen Peptide BRLF1 109–117 HLA-A*02:01 (YVLDHLIVV) for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. Allele: A*02:01 Molecular Weight: 1070.31 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BRLF1 109–117 (HLA-A*02:01) | YVLDHLIVV | 5 mg | ≥ 95% | EP11139_5 | 100 EUR | Add to cart |
DescriptionAntigen Peptide BRLF1 109–117 HLA-A*02:01 (YVLDHLIVV) for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. Allele: A*02:01 Molecular Weight: 1070.31 Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BRLF1 134-142 (HLA-A*11:01) | ATIGTAMYK | 1 mg | ≥ 95% | EP11140_1 | 50 EUR | Add to cart |
DescriptionHLA-A11 restricted epitope from Epstein-Barr Virus BRLF1 (134-142) is a linear peptidic epitope (epitope ID 5002) studied as part of Replication and transcription activator from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BRLF1 134-142 (HLA-A*11:01) | ATIGTAMYK | 5 mg | ≥ 95% | EP11140_5 | 100 EUR | Add to cart |
DescriptionHLA-A11 restricted epitope from Epstein-Barr Virus BRLF1 (134-142) is a linear peptidic epitope (epitope ID 5002) studied as part of Replication and transcription activator from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BRLF1 28-37 (HLA-A*24:02) | DYCNVLNKEF | 1 mg | ≥ 95% | EP11141_1 | 50 EUR | Add to cart |
DescriptionAntigen Peptide EBV BRLF1 28-37 (HLA-A*24:02) DYCNVLNKEF for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BRLF1 28-37 (HLA-A*24:02) | DYCNVLNKEF | 5 mg | ≥ 95% | EP11141_5 | 100 EUR | Add to cart |
DescriptionAntigen Peptide EBV BRLF1 28-37 (HLA-A*24:02) DYCNVLNKEF for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BZLF-1 190-197 (HLA-B*08:01) | RAKFKQLL | 1 mg | ≥ 95% | EP07899_1 | 50 EUR | Add to cart |
DescriptionAntigen peptide RAKFKQLL for stimulation of human EBV BZLF-1(190-197)-specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*0801 allele. RAKFKQLL is a linear peptidic epitope (epitope ID53128) studied as part of Trans-activator protein BZLF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BZLF-1 190-197 (HLA-B*08:01) | RAKFKQLL | 5 mg | ≥ 95% | EP07899_5 | 100 EUR | Add to cart |
DescriptionAntigen peptide RAKFKQLL for stimulation of human EBV BZLF-1(190-197)-specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*0801 allele. RAKFKQLL is a linear peptidic epitope (epitope ID53128) studied as part of Trans-activator protein BZLF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BZLF-1 54-64 (HLA-B*35:01) | EPLPQGQLTAY | 1 mg | ≥ 95% | EP11143_1 | 100 EUR | Add to cart |
DescriptionAntigen Peptide EBV BZLF1 HLA-B*3501 (EPLPQGQLTAY) for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. EPLPQGQLTAY is a linear peptidic epitope (epitope ID13701) studied as part of Trans-activator protein BZLF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity tested in T cell assays and MHC ligand assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BZLF-1 54-64 (HLA-B*35:01) | EPLPQGQLTAY | 5 mg | ≥ 95% | EP11143_5 | 170 EUR | Add to cart |
DescriptionAntigen Peptide EBV BZLF1 HLA-B*3501 (EPLPQGQLTAY) for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. EPLPQGQLTAY is a linear peptidic epitope (epitope ID13701) studied as part of Trans-activator protein BZLF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity tested in T cell assays and MHC ligand assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV BZLF-1 54-64 mutant (HLA-B*35:01) | EPLSQSQITAY | 1 mg | ≥ 95% | EP11144_1 | 100 EUR | Add to cart |
Descriptionsterile and endotoxin free |
||||||
EBV BZLF-1 54-64 mutant (HLA-B*35:01) | EPLSQSQITAY | 5 mg | ≥ 95% | EP11144_5 | 170 EUR | Add to cart |
Descriptionsterile and endotoxin free |
||||||
EBV BZLF1 44-52 (HLA-B*07:02) | LPCVLWPVL | 1 mg | ≥95% | EP11214_1 | 50 EUR | Add to cart |
DescriptionLPCVLWPVL is a linear peptidic epitope studied as part of Trans-activator protein BZLF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free
|
||||||
EBV BZLF1 44-52 (HLA-B*07:02) | LPCVLWPVL | 5 mg | ≥95% | EP11214_5 | 100 EUR | Add to cart |
DescriptionLPCVLWPVL is a linear peptidic epitope studied as part of Trans-activator protein BZLF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA 3A 246–253 (HLA-A*24:02) | RYSIFFDY | 1 mg | ≥ 95% | EP11147_1 | 50 EUR | Add to cart |
DescriptionRYSIFFDY is a linear peptidic epitope (epitope ID 56650) studied as part of Epstein-Barr nuclear antigen 3 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA 3A 246–253 (HLA-A*24:02) | RYSIFFDY | 5 mg | ≥ 95% | EP11147_5 | 100 EUR | Add to cart |
DescriptionRYSIFFDY is a linear peptidic epitope (epitope ID 56650) studied as part of Epstein-Barr nuclear antigen 3 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA 3B 399-408 (HLA-A*11:01) | AVFDRKSDAK | 1 mg | ≥ 95% | EP11150_1 | 50 EUR | Add to cart |
DescriptionAntigen Peptide EBV EBNA3B 399-408 (HLA-A*11:01) AVFDRKSDAK for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA 3B 399-408 (HLA-A*11:01) | AVFDRKSDAK | 5 mg | ≥ 95% | EP11150_5 | 100 EUR | Add to cart |
DescriptionAntigen Peptide EBV EBNA3B 399-408 (HLA-A*11:01) AVFDRKSDAK for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA 3C 258-266 (HLA-B*27:02)(HLA-B*27:05)(HLA-B*27:04) | RRIYDLIEL | 1 mg | ≥ 95% | EP11481_1 | 50 EUR | Add to cart |
DescriptionRRIYDLIEL is a linear peptidic epitope (epitope ID55620) studied as part of Epstein-Barr nuclear antigen 6 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA 3C 258-266 (HLA-B*27:02)(HLA-B*27:05)(HLA-B*27:04) | RRIYDLIEL | 5 mg | ≥ 95% | EP11481_5 | 100 EUR | Add to cart |
DescriptionRRIYDLIEL is a linear peptidic epitope (epitope ID55620) studied as part of Epstein-Barr nuclear antigen 6 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-1 407-417 (HLA-B*35:01) | HPVGEADYFEY | 1 mg | ≥ 95% | EP08274_1 | 50 EUR | Add to cart |
DescriptionAntigen Peptide EBV EBNA-1 407-417 (HLA-B*35:01) HPVGEADYFEY for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. ngle peptide (HPVGEADYFEY) for stimulation of human EBV EBNA-1-specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*3501 allele. HPVGEADYFEY is a linear peptidic epitope (epitope ID24536) studied as part of Epstein-Barr nuclear antigen 1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-1 407-417 (HLA-B*35:01) | HPVGEADYFEY | 5 mg | ≥ 95% | EP08274_5 | 100 EUR | Add to cart |
DescriptionAntigen Peptide EBV EBNA-1 407-417 (HLA-B*35:01) HPVGEADYFEY for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. ngle peptide (HPVGEADYFEY) for stimulation of human EBV EBNA-1-specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*3501 allele. HPVGEADYFEY is a linear peptidic epitope (epitope ID24536) studied as part of Epstein-Barr nuclear antigen 1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-1 407-417 mutant (HLA-B*35:01) 410A | HPVAEADYFEY | 1 mg | ≥ 95% | EP11145_1 | 80 EUR | Add to cart |
DescriptionEBNA1-derived peptide of HPVAEADYFEY covering 407-417 and B*35:08 molecule. HPVAEADYFEY is a linear peptidic epitope (epitope ID 227777) studied as part of Epstein-Barr nuclear antigen 1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-1 407-417 mutant (HLA-B*35:01) 410A | HPVAEADYFEY | 5 mg | ≥ 95% | EP11145_5 | 150 EUR | Add to cart |
DescriptionEBNA1-derived peptide of HPVAEADYFEY covering 407-417 and B*35:08 molecule. HPVAEADYFEY is a linear peptidic epitope (epitope ID 227777) studied as part of Epstein-Barr nuclear antigen 1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-1 407-417 mutant (HLA-B*35:01) 411D | HPVGDADYFEY | 1 mg | ≥ 95% | EP11146_1 | 80 EUR | Add to cart |
DescriptionEBV EBNA1-derived peptide of HPVGDADYFEY covering 407-417 and B*35:08 molecule. HPVGDADYFEY is a linear peptidic epitope (epitope ID 24525) studied as part of Epstein-Barr nuclear antigen 1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-1 407-417 mutant (HLA-B*35:01) 411D | HPVGDADYFEY | 5 mg | ≥ 95% | EP11146_5 | 150 EUR | Add to cart |
DescriptionEBV EBNA1-derived peptide of HPVGDADYFEY covering 407-417 and B*35:08 molecule. HPVGDADYFEY is a linear peptidic epitope (epitope ID 24525) studied as part of Epstein-Barr nuclear antigen 1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-1 72–80 (HLA-B*35:01) | RPQKRPSCI | 1 mg | ≥95% | EP14015_1 | 50 EUR | Add to cart |
DescriptionRPQKRPSCI is a linear peptidic epitope studied as part of Epstein-Barr nuclear antigen 1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-1 72–80 (HLA-B*35:01) | RPQKRPSCI | 5 mg | ≥95% | EP14015_5 | 100 EUR | Add to cart |
DescriptionRPQKRPSCI is a linear peptidic epitope studied as part of Epstein-Barr nuclear antigen 1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-3A 325-333 (HLA-B*08:01) | FLRGRAYGL | 1 mg | ≥ 95% | EP06163_1 | 50 EUR | Add to cart |
DescriptionAntigen Peptide EBV EBNA3A HLA-B*0801 (FLRGRAYGL) for stimulation of human EBV EBNA-3A(325-333) -specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*0801 allele. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-3A 325-333 (HLA-B*08:01) | FLRGRAYGL | 5 mg | ≥ 95% | EP06163_5 | 100 EUR | Add to cart |
DescriptionAntigen Peptide EBV EBNA3A HLA-B*0801 (FLRGRAYGL) for stimulation of human EBV EBNA-3A(325-333) -specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*0801 allele. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-3A 379-387 (HLA-B*07:02) | RPPIFIRRL | 1 mg | ≥ 95% | EP05817_1 | 50 EUR | Add to cart |
DescriptionAntigen Peptide EBV EBNA3A HLA-B*0702 (RPPIFIRRL) for stimulation of human EBV EBNA-3A (379-387) specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*0702 allele. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-3A 379-387 (HLA-B*07:02) | RPPIFIRRL | 5 mg | ≥ 95% | EP05817_5 | 100 EUR | Add to cart |
DescriptionAntigen Peptide EBV EBNA3A HLA-B*0702 (RPPIFIRRL) for stimulation of human EBV EBNA-3A (379-387) specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*0702 allele. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-3A 458-466 (HLA-B*35:01) | YPLHEQHGM | 1 mg | ≥ 95% | EP11148_1 | 50 EUR | Add to cart |
DescriptionHLA-B35-restricted epitope from Epstein-Barr Virus latent nuclear antigen 3A (458-466) for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-3A 458-466 (HLA-B*35:01) | YPLHEQHGM | 5 mg | ≥ 95% | EP11148_5 | 100 EUR | Add to cart |
DescriptionHLA-B35-restricted epitope from Epstein-Barr Virus latent nuclear antigen 3A (458-466) for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-3A 603-611 (HLA-A*03:01) | RLRAEAQVK | 1 mg | ≥ 95% | EP07892_1 | 50 EUR | Add to cart |
DescriptionRLRAEAQVK is a linear peptidic epitope (epitope ID54728) studied as part of Epstein-Barr nuclear antigen 3 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-3A 603-611 (HLA-A*03:01) | RLRAEAQVK | 5 mg | ≥ 95% | EP07892_5 | 100 EUR | Add to cart |
DescriptionRLRAEAQVK is a linear peptidic epitope (epitope ID54728) studied as part of Epstein-Barr nuclear antigen 3 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-3C 284-293 (HLA-A*02:01) | LLDFVRFMGV | 1 mg | ≥ 95% | EP11149_1 | 50 EUR | Add to cart |
DescriptionLLDFVRFMGV is a linear peptidic epitope (epitope ID 37153) studied as part of Epstein-Barr nuclear antigen 6 from Human herpesvirus 4 (Epstein Barr virus) and Other Human herpesvirus 4 (Epstein Barr virus) protein from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-3C 284-293 (HLA-A*02:01) | LLDFVRFMGV | 5 mg | ≥ 95% | EP11149_5 | 100 EUR | Add to cart |
DescriptionLLDFVRFMGV is a linear peptidic epitope (epitope ID 37153) studied as part of Epstein-Barr nuclear antigen 6 from Human herpesvirus 4 (Epstein Barr virus) and Other Human herpesvirus 4 (Epstein Barr virus) protein from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-3C 881-889 (HLA-B*07:02) | QPRAPIRPI | 1 mg | ≥ 95% | EP11152_1 | 50 EUR | Add to cart |
DescriptionQPRAPIRPI is a linear peptidic epitope (epitope ID 51946) studied as part of Epstein-Barr nuclear antigen 6 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA-3C 881-889 (HLA-B*07:02) | QPRAPIRPI | 5 mg | ≥ 95% | EP11152_5 | 100 EUR | Add to cart |
DescriptionQPRAPIRPI is a linear peptidic epitope (epitope ID 51946) studied as part of Epstein-Barr nuclear antigen 6 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA3A 158-166 (HLA-B*08:01) | QAKWRLQTL | 1 mg | ≥ 95% | EP11153_1 | 50 EUR | Add to cart |
DescriptionQAKWRLQTL is a linear peptidic epitope (epitope ID50298) studied as part of Epstein-Barr nuclear antigen 3 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA3A 158-166 (HLA-B*08:01) | QAKWRLQTL | 5 mg | ≥ 95% | EP11153_5 | 100 EUR | Add to cart |
DescriptionQAKWRLQTL is a linear peptidic epitope (epitope ID50298) studied as part of Epstein-Barr nuclear antigen 3 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA3B 416-424 (HLA-A*11:01; HLA-A*68:01) | IVTDFSVIK | 1 mg | ≥ 95% | EP11151_1 | 50 EUR | Add to cart |
DescriptionAntigen Peptide EBV EBNA3B 416-424 (HLA-A*11:01; ; HLA-A*6801) IVTDFSVIK for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA3B 416-424 (HLA-A*11:01; HLA-A*68:01) | IVTDFSVIK | 5 mg | ≥ 95% | EP11151_5 | 100 EUR | Add to cart |
DescriptionAntigen Peptide EBV EBNA3B 416-424 (HLA-A*11:01; ; HLA-A*6801) IVTDFSVIK for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. Delivery Format: The product is supplied freeze dried as trifluoracetate salt sterile and endotoxin free |
||||||
EBV EBNA3C 281 – 290 (HLA-B*44:05) | EENLLDFVRF | 1 mg | ≥ 95% | EP11483_1 | 50 EUR |