This website uses cookies

This website uses cookies to improve user experience. By using our website you consent to all cookies in accordance with our Cookie Policy.

Product Finder




peptides&elephants sells products and services to companies and non-profit institutions only and not to individuals without business or academic affiliations.

Name Sequence Amount Purity Order# Price  
[beta]-Amyloid (1-14) , mouse, rat DAEFGHDSGFEVRH 1 mg ≥ 95% EP10016_1 130 EUR Add to cart


Molecular Formula: C69H95N21O24
Molecular Weight: 1603.7

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

[beta]-Amyloid (1-14) , mouse, rat DAEFGHDSGFEVRH 5 mg ≥ 95% EP10016_5 180 EUR Add to cart


Molecular Formula: C69H95N21O24
Molecular Weight: 1603.7

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

[beta]-Amyloid (1-16) DAEFRHDSGYEVHHQK 1 mg ≥ 95% EP10023_1 70 EUR Add to cart


Proteins interactions with reactive oxygen agents may result in covalent modifications of amino acid residues in proteins, formation of protein-protein cross-linkages and oxidation of the protein backbone resulting in protein fragmentation. Oxidation targets for Aß(1-16) are the histidine residues coordinated to the metal ions. Copper is bound to Aß in senile plaque of Alzheimer’s disease with Aß (1-16) taking part in the coordination of the Cu2+ ions. Cu2+ and Zn2+ are linked with the neurotoxicity of Aß and free radical damage.

DAEFRHDSGYEVHHQK is a linear peptidic epitope (epitope ID7491) studied as part of Amyloid beta A4 protein from Homo sapiens (human) and Gamma-secretase C-terminal fragment 59 from Homo sapiens (human). This epitope has been studied for immune reactivity, tested in
T cell assays, B cell assays and MHC ligand assay.

Synonym: β-Amyloid (1-16), human
Molecular Formula: C₈₄H₁₁₉N₂₇O₂₈
Molecular Weight: 1955.03

Delivery Format: The product is supplied freeze dried as trifluoracetate salts.

sterile and endotoxin free

[beta]-Amyloid (1-16) DAEFRHDSGYEVHHQK 5 mg ≥ 95% EP10023_5 175 EUR Add to cart


Proteins interactions with reactive oxygen agents may result in covalent modifications of amino acid residues in proteins, formation of protein-protein cross-linkages and oxidation of the protein backbone resulting in protein fragmentation. Oxidation targets for Aß(1-16) are the histidine residues coordinated to the metal ions. Copper is bound to Aß in senile plaque of Alzheimer’s disease with Aß (1-16) taking part in the coordination of the Cu2+ ions. Cu2+ and Zn2+ are linked with the neurotoxicity of Aß and free radical damage.

DAEFRHDSGYEVHHQK is a linear peptidic epitope (epitope ID7491) studied as part of Amyloid beta A4 protein from Homo sapiens (human) and Gamma-secretase C-terminal fragment 59 from Homo sapiens (human). This epitope has been studied for immune reactivity, tested in
T cell assays, B cell assays and MHC ligand assay.

Synonym: β-Amyloid (1-16), human
Molecular Formula: C₈₄H₁₁₉N₂₇O₂₈
Relative Molecular Mass: 1955.03

Delivery Format: The product is supplied freeze dried as trifluoracetate salts.

sterile and endotoxin free


[beta]-Amyloid (1-40), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV 1 mg ≥ 95% EP10059_1 300 EUR Add to cart


Molecular Weight: 4233.8

Delivery Format: The product is supplied freeze dried as trifluoracetate salt.

sterile and endotoxin free

[beta]-Amyloid (1-40), rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV 5 mg ≥ 95% EP10059_5 700 EUR Add to cart


Molecular Weight: 4233.8

Delivery Format: The product is supplied freeze dried as trifluoracetate salt.

sterile and endotoxin free

[beta]-Casomorphin (1-7), bovine YPFPGPI 1 mg ≥ 95% EP10086_1 50 EUR Add to cart


β-Casomorphin-7 is a milk opioid peptide derived from fragment 60-66 of bovine beta-Casein. It strongly stimulates mucin secretion in the rat jejunum through a nervous pathway and mu-opioid receptor activation. The presence of the Tyr-Pro aromatic sequence makes the peptide selective for the mu receptor while the high contents of proline residues in the sequence makes the peptide resistant to degradation by gastrointestinal enzymes.

Synonyms: β-Casomorphin-7 (bovine), β-Casomorphin (1-7), bovine
Molecular Formula: C₄₁H₅₅N₇O₉
Molecular Weight: 789.93

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

[beta]-Casomorphin (1-7), bovine YPFPGPI 5 mg ≥ 95% EP10086_5 100 EUR Add to cart


β-Casomorphin-7 is a milk opioid peptide derived from fragment 60-66 of bovine beta-Casein. It strongly stimulates mucin secretion in the rat jejunum through a nervous pathway and mu-opioid receptor activation. The presence of the Tyr-Pro aromatic sequence makes the peptide selective for the mu receptor while the high contents of proline residues in the sequence makes the peptide resistant to degradation by gastrointestinal enzymes.

Synonyms: β-Casomorphin-7 (bovine), β-Casomorphin (1-7), bovine
Molecular Formula: C₄₁H₅₅N₇O₉
Molecular Weight: 789.93

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

[Trp63, 64] - C3a (63 - 77) WWGKKYRASKLGLAR 1 mg ≥ 95% EP10219_1 90 EUR Add to cart


(Trp63,Trp64)-C3a (63-77), synthetic superagonist analog of complement 3a, was 12-15 times more active than natural C3a.

This peptide, which is a C-terminal analogue of the complement factor C3a, acts as an agonist to the C3a receptor. It is derived from the fifteen C-terminal residues (6-77) of C3a. In in vitro studies, both C 3a and this peptide have been shown to selectively bind to C3aRs and induce degranulation of C3aR-transfeted RBL-2H3 cells. There was also a rapid, transient and concentration-dependent hypertensive response observed in rats when infused intravenously with C3a and this peptide.

Molecular Formula: C86H134N26O18
Molecular Weight: 1820.15

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

[Trp63, 64] - C3a (63 - 77) WWGKKYRASKLGLAR 5 mg ≥ 95% EP10219_5 225 EUR Add to cart


(Trp63,Trp64)-C3a (63-77), synthetic superagonist analog of complement 3a, was 12-15 times more active than natural C3a.

This peptide, which is a C-terminal analogue of the complement factor C3a, acts as an agonist to the C3a receptor. It is derived from the fifteen C-terminal residues (6-77) of C3a. In in vitro studies, both C 3a and this peptide have been shown to selectively bind to C3aRs and induce degranulation of C3aR-transfeted RBL-2H3 cells. There was also a rapid, transient and concentration-dependent hypertensive response observed in rats when infused intravenously with C3a and this peptide.

Molecular Formula: C86H134N26O18
Molecular Weight: 1820.15

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

3x FLAG DYKDDDDKDYKDDDDKDYKDDDDK 1 mg ≥ 95% EP07918_1 170 EUR Add to cart


This peptide represents a sequence of triple DYKDDDDK epitopes that is used in studying the function and structure of proteins. It has an increased sensitivity to the anti- DYKDDDDK M2 antibody and can be detected at lower abundance than the octomeric DYKDDDDK tag. A FLAG-tag can be used in many different assays that require recognition by an antibody. If there is no antibody against a given protein, adding a FLAG-tag to a protein allows the protein to be studied with an antibody against the FLAG sequence.

Molecular Formula: C123H176N30O58
Molecular Weight: 3002.91

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

3x FLAG DYKDDDDKDYKDDDDKDYKDDDDK 5 mg ≥ 95% EP07918_5 230 EUR Add to cart


This peptide represents a sequence of triple DYKDDDDK epitopes that is used in studying the function and structure of proteins. It has an increased sensitivity to the anti- DYKDDDDK M2 antibody and can be detected at lower abundance than the octomeric DYKDDDDK tag. A FLAG-tag can be used in many different assays that require recognition by an antibody. If there is no antibody against a given protein, adding a FLAG-tag to a protein allows the protein to be studied with an antibody against the FLAG sequence.

Molecular Formula: C123H176N30O58
Molecular Weight: 3002.91

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ABL1 40-48 (HLA-A*02:01) QQAHCLWCV 1 mg ≥ 95% EP11076_1 50 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: ABL1
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1087.30

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ABL1 40-48 (HLA-A*02:01) QQAHCLWCV 5 mg ≥ 95% EP11076_5 100 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: ABL1
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1087.30

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ABL1 44-53 (HLA-A*02:01) CLWCVPQLR 1 mg ≥ 95% EP11075_1 50 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: ABL1
Antigen Species: Human

Molecular Weight: 1117.41

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ABL1 44-53 (HLA-A*02:01) CLWCVPQLR 5 mg ≥ 95% EP11075_5 100 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: ABL1
Antigen Species: Human

Molecular Weight: 1117.41

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ACPP 299-307 (HLA-A*02:01) ALNVYNGLL 1 mg ≥ 95% EP10770_1 50 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: ACPP
Antigen Species: Human

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ACPP 299-307 (HLA-A*02:01) ALNVYNGLL 5 mg ≥ 95% EP10770_5 100 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: ACPP
Antigen Species: Human

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ACTH (1-10), human SYSMEHFRWG 1 mg ≥ 95% EP10595_1 50 EUR Add to cart


Adrenocorticotropic Hormones (ACTH). ACTH stimulates the adrenal cortex and the secretion of glucocorticoids such as cortisol.

Amino acids 1-10 of human adrenocorticotropic hormone (ACTH). ACTH, also known as corticotropin, is a tropic hormone produced and secreted by the anterior pituitary gland and member of the melanocortins peptide family. ACTH is cleaved from the precursor proopiomelanocortin (POMC). ACTH is an important component of the hypothalamic-pituitary-adrenal (HPA) axis and is often produced in response to biological stress. ACTH acts to increase the production and release of cortisol via its interaction with the ACTH receptor; ACTHR, also known as melanocortin type 2 receptor (MC2R). Receptor activation increases the intracellular concentration of cAMP via adenylyl cyclase.

Abnormal ACTH levels in the body has been linked to primary adrenal insufficiency/Addison's disease, Cushing's disease and secondary adrenal insufficiency.

Molecular Weight: 1299.44

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ACTH (1-10), human SYSMEHFRWG 5 mg ≥ 95% EP10595_5 100 EUR Add to cart


Adrenocorticotropic Hormones (ACTH). ACTH stimulates the adrenal cortex and the secretion of glucocorticoids such as cortisol.

Amino acids 1-10 of human adrenocorticotropic hormone (ACTH). ACTH, also known as corticotropin, is a tropic hormone produced and secreted by the anterior pituitary gland and member of the melanocortins peptide family. ACTH is cleaved from the precursor proopiomelanocortin (POMC). ACTH is an important component of the hypothalamic-pituitary-adrenal (HPA) axis and is often produced in response to biological stress. ACTH acts to increase the production and release of cortisol via its interaction with the ACTH receptor; ACTHR, also known as melanocortin type 2 receptor (MC2R). Receptor activation increases the intracellular concentration of cAMP via adenylyl cyclase.

Abnormal ACTH levels in the body has been linked to primary adrenal insufficiency/Addison's disease, Cushing's disease and secondary adrenal insufficiency.

Molecular Weight: 1299.44

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ACTH (1-24), human SYSMEHFRWGKPVGKKRRPVKVYP 1 mg ≥ 95% EP10598_1 110 EUR Add to cart


Adrenocorticotropic hormone (ACTH), also known as corticotropin (INN, BAN) (brand names Acortan, ACTH, Acthar, Acton, Cortigel, Trofocortina), is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of cortisol. Primary adrenal insufficiency, also called Addison's disease, occurs when adrenal gland production of cortisol is chronically deficient, resulting in chronically elevated ACTH levels; when a pituitary tumor is the cause of elevated ACTH (from the anterior pituitary) this is known as Cushing's disease and the constellation of signs and symptoms of the excess cortisol (hypercortisolism) is known as Cushing's syndrome. Conversely, deficiency of ACTH is a cause of secondary adrenal insufficiency, often as a result of hypopituitarism. ACTH is also related to the circadian rhythm in many organisms.

Neuropeptide ACTH (adenocorticotropin) amino acids (1-39), is the natural cleavage product from POMC (proopimelanocortin) processing; however, the first 24-amino acid sequence from the carboxyl end, ACTH (1-24) has full biological activity of the (1-39) peptide. Both ACTH (1-24) and (1-39) possess neurotropic activity. Potent ACTH/MC2 receptor agonist (EC50 = 5.5 nM). Stimulates glucocorticoid release from adrenal glands. Multiple biological activities. Anticancer reagent. Active in vivo.

Amino acids 1-24 of human adrenocorticotropic hormone (ACTH), induces glucocorticoid production by adrenal cells with the same potency as full length ACTH.

Molecular Formula: C136H210N40O31S
Molecular Weight: 2933.44

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ACTH (1-24), human SYSMEHFRWGKPVGKKRRPVKVYP 5 mg ≥ 95% EP10598_5 230 EUR Add to cart


Adrenocorticotropic hormone (ACTH), also known as corticotropin (INN, BAN) (brand names Acortan, ACTH, Acthar, Acton, Cortigel, Trofocortina), is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of cortisol. Primary adrenal insufficiency, also called Addison's disease, occurs when adrenal gland production of cortisol is chronically deficient, resulting in chronically elevated ACTH levels; when a pituitary tumor is the cause of elevated ACTH (from the anterior pituitary) this is known as Cushing's disease and the constellation of signs and symptoms of the excess cortisol (hypercortisolism) is known as Cushing's syndrome. Conversely, deficiency of ACTH is a cause of secondary adrenal insufficiency, often as a result of hypopituitarism. ACTH is also related to the circadian rhythm in many organisms.

Neuropeptide ACTH (adenocorticotropin) amino acids (1-39), is the natural cleavage product from POMC (proopimelanocortin) processing; however, the first 24-amino acid sequence from the carboxyl end, ACTH (1-24) has full biological activity of the (1-39) peptide. Both ACTH (1-24) and (1-39) possess neurotropic activity. Potent ACTH/MC2 receptor agonist (EC50 = 5.5 nM). Stimulates glucocorticoid release from adrenal glands. Multiple biological activities. Anticancer reagent. Active in vivo.

Amino acids 1-24 of human adrenocorticotropic hormone (ACTH), induces glucocorticoid production by adrenal cells with the same potency as full length ACTH.

Molecular Formula: C136H210N40O31S
Molecular Weight: 2933.44

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Adenovirus 5 Hexon 886-894 (HLA-A*01:01) TDLGQNLLY 1 mg ≥ 95% EP10774_1 50 EUR Add to cart


TDLGQNLLY is a linear peptidic epitope studied as part of Hexon protein from Human mastadenovirus C. This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay

Allele: A*01:01
Class: Class I
Antigen: Hexon
Antigen Species: Adenovirus

Molecular Weight: 1036.16

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Adenovirus 5 Hexon 886-894 (HLA-A*01:01) TDLGQNLLY 5 mg ≥ 95% EP10774_5 100 EUR Add to cart


TDLGQNLLY is a linear peptidic epitope studied as part of Hexon protein from Human mastadenovirus C. This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay

Allele: A*01:01
Class: Class I
Antigen: Hexon
Antigen Species: Adenovirus

Molecular Weight: 1036.16

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Adpgk Neoepitope (H-2D(b)) ASMTNMELM 1 mg ≥ 95% EP11850_1 50 EUR Add to cart


Allele: H-2Db
Class: Class I

Molecular Weight: 1027.25

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Adpgk Neoepitope (H-2D(b)) ASMTNMELM 5 mg ≥ 95% EP11850_5 100 EUR Add to cart


Allele: H-2Db
Class: Class I

Molecular Weight: 1027.25

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ADV hexon 114-124 (HLA-B*07:02) KPYSGTAYNAL 1 mg ≥ 95% EP07881_1 50 EUR Add to cart


KPYSGTAYNAL is a linear peptidic epitope (epitope ID174600) studied as part of Hexon protein from Human mastadenovirus C (Human adenovirus C). This epitope has been studied for immune reactivity and tested in T cell assays.

Allele: HLA-B*07:02
Class: Class I
Antigen: Hexon
Antigen Species: Adenovirus
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Respiratory infection

Molecular Weight: 1184.32

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free


ADV hexon 114-124 (HLA-B*07:02) KPYSGTAYNAL 5 mg ≥ 95% EP07881_5 100 EUR Add to cart


KPYSGTAYNAL is a linear peptidic epitope (epitope ID174600) studied as part of Hexon protein from Human mastadenovirus C (Human adenovirus C). This epitope has been studied for immune reactivity and tested in T cell assays.

Allele: HLA-B*07:02
Class: Class I
Antigen: Hexon
Antigen Species: Adenovirus
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Respiratory infection

Molecular Weight: 1184.32

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ADV hexon 320-329 (HLA-B*35:01) MPNRPNYIAF 1 mg ≥ 95% EP07882_1 50 EUR Add to cart


Allele: B*07:02
Class: Class I
Antigen: Hexon
Antigen Species: Adenovirus
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Respiratory infection

Molecular Weight: 1222.44

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ADV hexon 320-329 (HLA-B*35:01) MPNRPNYIAF 5 mg ≥ 95% EP07882_5 100 EUR Add to cart


Allele: B*07:02
Class: Class I
Antigen: Hexon
Antigen Species: Adenovirus
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Respiratory infection

Molecular Weight: 1222.44

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ADV hexon 37-45 (HLA-A*24:02) TYFSLNNKF 1 mg ≥ 95% EP07880_1 50 EUR Add to cart


TYFSLNNKF is a linear peptidic epitope (epitope ID67338) studied as part of Hexon protein from Human mastadenovirus C (Human adenovirus C). This epitope has been studied for immune reactivity and tested in
T cell assays

Allele: HLA-A*24:02
Class: Class I
Antigen: HAdV5 Hexon
Antigen Species: HAdV5
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Respiratory infection

Molecular Weight: 1133.27

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ADV hexon 37-45 (HLA-A*24:02) TYFSLNNKF 5 mg ≥ 95% EP07880_5 100 EUR Add to cart


TYFSLNNKF is a linear peptidic epitope (epitope ID67338) studied as part of Hexon protein from Human mastadenovirus C (Human adenovirus C). This epitope has been studied for immune reactivity and tested in
T cell assays

Allele: HLA-A*24:02
Class: Class I
Antigen: HAdV5 Hexon
Antigen Species: HAdV5
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Respiratory infection

Molecular Weight: 1133.27

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ADV Hexon 917-925 (HLA-A*02:01) YVLFEVFDV 1 mg ≥ 95% EP07914_1 50 EUR Add to cart


Single peptide (YVLFEVFDV) for stimulation of human ADV Hexon (917-925)-specific CD8+ T cells.

Allele: HLA-A*02:01
Class: Class I
Antigen: HAdV5 Hexon
Antigen Species: HAdV5

Molecular Weight: 1130.32

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

ADV Hexon 917-925 (HLA-A*02:01) YVLFEVFDV 5 mg ≥ 95% EP07914_5 100 EUR Add to cart


Single peptide (YVLFEVFDV) for stimulation of human ADV Hexon (917-925)-specific CD8+ T cells.

Allele: HLA-A*02:01
Class: Class I
Antigen: HAdV5 Hexon
Antigen Species: HAdV5

Molecular Weight: 1130.32

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Anti-H60a 39-46 (H-2Kb) LTFNYRNL 1 mg ≥ 95% EP11648_1 50 EUR Add to cart


LTFNYRNL is a linear peptidic epitope (epitope ID139167) studied as part of Histocompatibility-60b from Mus musculus (mouse). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Antigen peptide composed of Histocompatibility antigen 60-derived peptide of LTFNYRNL sequence covering 39-46 and H-2Kb molecule. The peptide recognizes mouse CD8 T cells, and can be used in the analysis of individual antigen-specific T cells.

Allele: H-2Kb
Class: Class I
Antigen: Histocompatibility antigen 60
Antigen Species: Zaire ebolavirus

Molecular Weight: 1040.20

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Anti-H60a 39-46 (H-2Kb) LTFNYRNL 5 mg ≥ 95% EP11648_5 100 EUR Add to cart


LTFNYRNL is a linear peptidic epitope (epitope ID139167) studied as part of Histocompatibility-60b from Mus musculus (mouse). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Antigen peptide composed of Histocompatibility antigen 60-derived peptide of LTFNYRNL sequence covering 39-46 and H-2Kb molecule. The peptide recognizes mouse CD8 T cells, and can be used in the analysis of individual antigen-specific T cells.

Allele: H-2Kb
Class: Class I
Antigen: Histocompatibility antigen 60
Antigen Species: Zaire ebolavirus

Molecular Weight: 1040.20

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Arg9 RRRRRRRRR 1 mg ≥ 95% EP09843_1 50 EUR Add to cart


This is a peptide comprising of 9 arginine residues. It has been shown that poly-Arg peptides composed of 9 arginine residues are able to efficiently translocate across cells. It has also been shown in model systems that Arg-9 translocation involves nucleation of transient pores enabling flow of ions across the membrane and that it's electrostatic attraction to the phosphate groups of membranes is a key property for its translocation.

This poly-Arg, rich cell-penetrating peptide, is capable of traversing the plasma membranes of eukaryotic cells.

Molecular Weight: 1423.72

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Arg9 RRRRRRRRR 5 mg ≥ 95% EP09843_5 100 EUR Add to cart


This is a peptide comprising of 9 arginine residues. It has been shown that poly-Arg peptides composed of 9 arginine residues are able to efficiently translocate across cells. It has also been shown in model systems that Arg-9 translocation involves nucleation of transient pores enabling flow of ions across the membrane and that it's electrostatic attraction to the phosphate groups of membranes is a key property for its translocation.

This poly-Arg, rich cell-penetrating peptide, is capable of traversing the plasma membranes of eukaryotic cells.

Molecular Weight: 1423.72

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

B8R 20-27 (H-2 Kb) TSYKFESV 1 mg ≥ 95% EP08851_1 50 EUR Add to cart


TSYKFESV is a linear peptidic epitope (epitope ID66504) studied as part of Soluble interferon gamma receptor B8 from Vaccinia virus (vaccinia virus VV), interferon-gamma binding protein C4R from Ectromelia virus (Ectromelia mousepox virus) and CPXV202 protein from Cowpox virus. This epitope has been studied for immune reactivity and tested in
T cell assays and MHC ligand assays

This is amino acids 20 to 27 fragment of B8R, a vaccinia virus (VV) gene that encodes a secreted protein related to gamma interferon receptor (IFN-?). B8R binding to IFN-? neutralizes its antiviral activity.

Allele: H-2Kb
Class: Class I
Antigen: Vaccinia virus WR epitope B8R
Antigen Species: VACV
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Small Pox

Molecular Weight: 960.05

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free


B8R 20-27 (H-2 Kb) TSYKFESV 5 mg ≥ 95% EP08851_5 100 EUR Add to cart


TSYKFESV is a linear peptidic epitope (epitope ID66504) studied as part of Soluble interferon gamma receptor B8 from Vaccinia virus (vaccinia virus VV), interferon-gamma binding protein C4R from Ectromelia virus (Ectromelia mousepox virus) and CPXV202 protein from Cowpox virus. This epitope has been studied for immune reactivity and tested in
T cell assays and MHC ligand assays

This is amino acids 20 to 27 fragment of B8R, a vaccinia virus (VV) gene that encodes a secreted protein related to gamma interferon receptor (IFN-?). B8R binding to IFN-? neutralizes its antiviral activity.

Allele: H-2Kb
Class: Class I
Antigen: Vaccinia virus WR epitope B8R
Antigen Species: VACV
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Small Pox

Molecular Weight: 960.05

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BA46 194-202 (HLA-A*02:01) NLFETPVEA 1 mg ≥ 95% EP11078_1 50 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: ACPP
Antigen Species: Human

Molecular Weight: 1019.13

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BA46 194-202 (HLA-A*02:01) NLFETPVEA 5 mg ≥ 95% EP11078_5 100 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: ACPP
Antigen Species: Human

Molecular Weight: 1019.13

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BA46 97-106 (HLA-A*02:01) GLQHWVPEL 1 mg ≥ 95% EP11077_1 50 EUR Add to cart


This gene encodes a preproprotein that is proteolytically processed to form multiple protein products. The major encoded protein product, lactadherin, is a membrane glycoprotein that promotes phagocytosis of apoptotic cells. This protein has also been implicated in wound healing, autoimmune disease, and cancer. Lactadherin can be further processed to form a smaller cleavage product, medin, which comprises the major protein component of aortic medial amyloid (AMA). Alternative splicing results in multiple transcript variants.

Allele: A*02:01
Class: Class I
Antigen: BA46
Antigen Species: Human

Molecular Weight: 1078.25

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BA46 97-106 (HLA-A*02:01) GLQHWVPEL 5 mg ≥ 95% EP11077_5 100 EUR Add to cart


This gene encodes a preproprotein that is proteolytically processed to form multiple protein products. The major encoded protein product, lactadherin, is a membrane glycoprotein that promotes phagocytosis of apoptotic cells. This protein has also been implicated in wound healing, autoimmune disease, and cancer. Lactadherin can be further processed to form a smaller cleavage product, medin, which comprises the major protein component of aortic medial amyloid (AMA). Alternative splicing results in multiple transcript variants.

Allele: A*02:01
Class: Class I
Antigen: BA46
Antigen Species: Human

Molecular Weight: 1078.25

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BAP31 167-175 (HLA-A*02:01) KLDVGNAEV 1 mg ≥ 95% EP11079_1 50 EUR Add to cart


KLDVGNAEV is a linear peptidic epitope (epitope ID445492) studied as part of B-cell receptor-associated protein 31 from Homo sapiens (human). This epitope has been studied for immune reactivity and tested in MHC ligand assays

Allele: A*02:01
Class: Class I
Antigen: BCAP31
Antigen Species: Human

Molecular Weight: 944.05

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BAP31 167-175 (HLA-A*02:01) KLDVGNAEV 5 mg ≥ 95% EP11079_5 100 EUR Add to cart


KLDVGNAEV is a linear peptidic epitope (epitope ID445492) studied as part of B-cell receptor-associated protein 31 from Homo sapiens (human). This epitope has been studied for immune reactivity and tested in MHC ligand assays

Allele: A*02:01
Class: Class I
Antigen: BCAP31
Antigen Species: Human

Molecular Weight: 944.05

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Bcl-2 180-189 (HLA-A*02:01) YLNRHLHTWI 1 mg ≥ 95% EP11083_1 50 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: BCL2
Antigen Species: Human

Molecular Weight: 1352.57

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Bcl-2 180-189 (HLA-A*02:01) YLNRHLHTWI 5 mg ≥ 95% EP11083_5 100 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: BCL2
Antigen Species: Human

Molecular Weight: 1352.57

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCL-2 208-217 (HLA-A*02:01) PLFDFSWLSL 1 mg ≥ 95% EP11081_1 50 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: BCL2
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1224.43

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCL-2 208-217 (HLA-A*02:01) PLFDFSWLSL 5 mg ≥ 95% EP11081_5 100 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: BCL2
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1224.43

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCL-2 85-93 (HLA-A*02:01) ALSPVPPVV 1 mg ≥ 95% EP11080_1 50 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: BCL2
Antigen Species: Human
Application(s): Immune monitoring, Immunohistochemistry
Indication(s)/Topic(s): Cancer

Molecular Weight: 878.09

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free


BCL-2 85-93 (HLA-A*02:01) ALSPVPPVV 5 mg ≥ 95% EP11080_5 100 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: BCL2
Antigen Species: Human
Application(s): Immune monitoring, Immunohistochemistry
Indication(s)/Topic(s): Cancer

Molecular Weight: 878.09

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCL-2A1 15-23 (HLA-A*24:02) DYLQYVLQI 1 mg ≥ 95% EP11084_1 50 EUR Add to cart


DYLQYVLQI is a linear peptidic epitope (epitope ID 140993) studied as part of Bcl-2-related protein A1 from Homo sapiens (human). This epitope has been studied for immune reactivity in and was tested in T cell assays

Allele: A*24:02
Class: Class I
Antigen: BCL2A1
Antigen Species: Human

Molecular Weight: 1154.34

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCL-2A1 15-23 (HLA-A*24:02) DYLQYVLQI 5 mg ≥ 95% EP11084_5 100 EUR Add to cart


DYLQYVLQI is a linear peptidic epitope (epitope ID 140993) studied as part of Bcl-2-related protein A1 from Homo sapiens (human). This epitope has been studied for immune reactivity in and was tested in T cell assays

Allele: A*24:02
Class: Class I
Antigen: BCL2A1
Antigen Species: Human

Molecular Weight: 1154.34

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCL-2L1 165-173 (HLA-A*03:01) RIAAWMATY 1 mg ≥ 95% EP11085_1 50 EUR Add to cart


Allele: A*03:01
Class: Class I
Antigen: BCL2L1
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1082.30

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCL-2L1 165-173 (HLA-A*03:01) RIAAWMATY 5 mg ≥ 95% EP11085_5 100 EUR Add to cart


Allele: A*03:01
Class: Class I
Antigen: BCL2L1
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1082.30

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCL2-like 1 173-182 (HLA-A*02:01) YLNDHLEPWI 1 mg ≥ 95% EP11086_1 50 EUR Add to cart


Allele: A*03:01
Class: Class I
Antigen: BCL2L1
Antigen Species: Human

Molecular Weight: 1299.46

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCL2-like 1 173-182 (HLA-A*02:01) YLNDHLEPWI 5 mg ≥ 95% EP11086_5 100 EUR Add to cart


Allele: A*03:01
Class: Class I
Antigen: BCL2L1
Antigen Species: Human

Molecular Weight: 1299.46

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCR-ABL (HLA-A*02:01) GVRGRVEEI 1 mg ≥ 95% EP11087_1 50 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: BCR-ABL
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1014.16

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCR-ABL (HLA-A*02:01) GVRGRVEEI 5 mg ≥ 95% EP11087_5 100 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: BCR-ABL
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1014.16

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCR-ABL 19-27 (HLA-B*27:01) GFKQSSKAL 1 mg ≥ 95% EP11090_1 50 EUR Add to cart


Tumor Antigen-derived Peptide.

GFKQSSKAL is a linear peptidic epitope (epitope ID19558) studied as part of Other Homo sapiens (human) protein from Homo sapiens (human), tested in MHC ligand assay

Allele: B*27:01
Class: Class I
Antigen: ABL1
Antigen Species: Human

Molecular Weight: 965.11

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCR-ABL 19-27 (HLA-B*27:01) GFKQSSKAL 5 mg ≥ 95% EP11090_5 100 EUR Add to cart


Tumor Antigen-derived Peptide.

GFKQSSKAL is a linear peptidic epitope (epitope ID19558) studied as part of Other Homo sapiens (human) protein from Homo sapiens (human), tested in MHC ligand assay

Allele: B*27:01
Class: Class I
Antigen: ABL1
Antigen Species: Human

Molecular Weight: 965.11

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCR-ABL 21-29 (HLA-A*03:01) KQSSKALQR 1 mg ≥ 95% EP11089_1 50 EUR Add to cart


Tumor Antigen-derived Peptide

KQSSKALQR is a linear peptidic epitope (epitope ID 33075) studied as part of Other Homo sapiens (human) protein from Homo sapiens (human). This epitope has been studied for immune reactivity, and was tested in MHC ligand assays

Allele: A*03:01
Class: Class I
Antigen: ABL1
Antigen Species: Human

Molecular Weight: 1045.20

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCR-ABL 21-29 (HLA-A*03:01) KQSSKALQR 5 mg ≥ 95% EP11089_5 100 EUR Add to cart


Tumor Antigen-derived Peptide

KQSSKALQR is a linear peptidic epitope (epitope ID 33075) studied as part of Other Homo sapiens (human) protein from Homo sapiens (human). This epitope has been studied for immune reactivity, and was tested in MHC ligand assays

Allele: A*03:01
Class: Class I
Antigen: ABL1
Antigen Species: Human

Molecular Weight: 1045.20

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCR-ABL 259-269 (HLA-A*03:01) (HLA-A*11:01) ATGFKQSSK 1 mg ≥ 95% EP11088_1 50 EUR Add to cart


ATGFKQSSK is a linear peptidic epitope (epitope ID 4966) studied as part of Other Homo sapiens (human) protein from Homo sapiens (human), tested in MHC ligand assays

Allele: HLA-A*03:01, HLA-A*11:01
Class: Class I
Antigen: BCR-ABL
Antigen Species: Human

Molecular Weight: 953.05

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BCR-ABL 259-269 (HLA-A*03:01) (HLA-A*11:01) ATGFKQSSK 5 mg ≥ 95% EP11088_5 100 EUR Add to cart


ATGFKQSSK is a linear peptidic epitope (epitope ID 4966) studied as part of Other Homo sapiens (human) protein from Homo sapiens (human), tested in MHC ligand assays

Allele: HLA-A*03:01, HLA-A*11:01
Class: Class I
Antigen: BCR-ABL
Antigen Species: Human

Molecular Weight: 953.05

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BGLAP (HLA-A*24:02) LYQWLGAPV 1 mg ≥ 95% EP11092_1 50 EUR Add to cart


Allele: A*24:02
Class: Class I
Antigen: BGLAP
Antigen Species: Human

Molecular Weight: 1046.24

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BGLAP (HLA-A*24:02) LYQWLGAPV 5 mg ≥ 95% EP11092_5 100 EUR Add to cart


Allele: A*24:02
Class: Class I
Antigen: BGLAP
Antigen Species: Human

Molecular Weight: 1046.24

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BGLAP 1-10 (HLA-A*02:01) YLYQWLGAPV 1 mg ≥ 95% EP11091_1 50 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: BGLAP
Antigen Species: Human

Molecular Weight: 1209.42

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BGLAP 1-10 (HLA-A*02:01) YLYQWLGAPV 5 mg ≥ 95% EP11091_5 100 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: BGLAP
Antigen Species: Human

Molecular Weight: 1209.42

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BKV Large T antigen 406-414 (HLA-A*02:01) VIFDFLHCI 1 mg ≥ 95% EP11094_1 50 EUR Add to cart


VIFDFLHCI is a linear peptidic epitope (epitope ID 68945 ) studied as part of Human polyomavirus 1 protein from Human polyomavirus 1. This epitope has been studied for immune reactivity and was tested in T cell assays and MHC ligand assay

Allele: A*02:01
Class: Class I
Antigen: Large T
Antigen Species: Human polyomavirus 1

Molecular Weight: 1106.36

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BKV Large T antigen 406-414 (HLA-A*02:01) VIFDFLHCI 5 mg ≥ 95% EP11094_5 100 EUR Add to cart


VIFDFLHCI is a linear peptidic epitope (epitope ID 68945 ) studied as part of Human polyomavirus 1 protein from Human polyomavirus 1. This epitope has been studied for immune reactivity and was tested in T cell assays and MHC ligand assay

Allele: A*02:01
Class: Class I
Antigen: Large T
Antigen Species: Human polyomavirus 1

Molecular Weight: 1106.36

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BKV Large T antigen 579-587 (HLA-A*02:01) LLLIWFRPV 1 mg ≥ 95% EP11093_1 50 EUR Add to cart


BKV LT-ag peptide LLLIWFRPV (HLA-B*0201) for stimulation of human BKV LT-ag(579-587)-specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allele.

LLLIWFRPV is a linear peptidic epitope (epitope ID37507) studied as part of Human polyomavirus 1 (polyomavirus BK) protein from Human polyomavirus 1 (BK polyomavirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay.

Allele: A*02:01
Class: Class I
Antigen: Large T
Antigen Species: Human polyomavirus 1
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1156.49

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BKV Large T antigen 579-587 (HLA-A*02:01) LLLIWFRPV 5 mg ≥ 95% EP11093_5 100 EUR Add to cart


BKV LT-ag peptide LLLIWFRPV (HLA-B*0201) for stimulation of human BKV LT-ag(579-587)-specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allele.

LLLIWFRPV is a linear peptidic epitope (epitope ID37507) studied as part of Human polyomavirus 1 (polyomavirus BK) protein from Human polyomavirus 1 (BK polyomavirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay.

Allele: A*02:01
Class: Class I
Antigen: Large T
Antigen Species: Human polyomavirus 1
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1156.49

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BMI1 271–279 (HLA-A*02:01) CLPSPSTPV 1 mg ≥ 95% EP11099_1 50 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: BMI1
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 900.07

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BMI1 271–279 (HLA-A*02:01) CLPSPSTPV 5 mg ≥ 95% EP11099_5 100 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: BMI1
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 900.07

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BMI1 74-82 (HLA-A*02:01) TLQDIVYKL 1 mg ≥ 95% EP11100_1 50 EUR Add to cart


TLQDIVYKL is a linear peptidic epitope (epitope ID 459976) studied as part of Polycomb complex protein BMI-1 from Homo sapiens (human) and Polycomb group RING finger protein 2 from Homo sapiens (human). This epitope has been studied for immune reactivity in and was tested in MHC ligand assays.

Allele: A*02:01
Class: Class I
Antigen: BMI1
Antigen Species: Human

Molecular Weight: 1092.30

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BMI1 74-82 (HLA-A*02:01) TLQDIVYKL 5 mg ≥ 95% EP11100_5 100 EUR Add to cart


TLQDIVYKL is a linear peptidic epitope (epitope ID 459976) studied as part of Polycomb complex protein BMI-1 from Homo sapiens (human) and Polycomb group RING finger protein 2 from Homo sapiens (human). This epitope has been studied for immune reactivity in and was tested in MHC ligand assays.

Allele: A*02:01
Class: Class I
Antigen: BMI1
Antigen Species: Human

Molecular Weight: 1092.30

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BRAF 594-601 (HLA-B*27:05) (600E) GRFGLATEK 1 mg ≥ 95% EP11101_1 50 EUR Add to cart


Allele: B*27:05
Class: Class I
Antigen: BRAF
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 978.11

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BRAF 594-601 (HLA-B*27:05) (600E) GRFGLATEK 5 mg ≥ 95% EP11101_5 100 EUR Add to cart


Allele: B*27:05
Class: Class I
Antigen: BRAF
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 978.11

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BRAF 594-601 (HLA-B*27:05) (600V) GRFGLATVK 1 mg ≥ 95% EP11102_1 50 EUR Add to cart


Allele: B*27:05
Class: Class I
Antigen: BRAF
Antigen Species: Human

Molecular Weight: 948.13

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

BRAF 594-601 (HLA-B*27:05) (600V) GRFGLATVK 5 mg ≥ 95% EP11102_5 100 EUR Add to cart


Allele: B*27:05
Class: Class I
Antigen: BRAF
Antigen Species: Human

Molecular Weight: 948.13

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Carbonic anhydrase 219-227 (HLA-A*24:02) EYRALQLHL 1 mg ≥ 95% EP11106_1 50 EUR Add to cart


Allele: A*24:02
Class: Class I
Antigen: Carbonic Anhydrase 9
Antigen Species: Human

Molecular Weight: 1142.33

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Carbonic anhydrase 219-227 (HLA-A*24:02) EYRALQLHL 5 mg ≥ 95% EP11106_5 100 EUR Add to cart


Allele: A*24:02
Class: Class I
Antigen: Carbonic Anhydrase 9
Antigen Species: Human

Molecular Weight: 1142.33

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CB9L2 (HLA-A*02:01) ALYLMELTM 1 mg ≥ 95% EP11107_1 50 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: CB9L2

Molecular Weight: 1084.50

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CB9L2 (HLA-A*02:01) ALYLMELTM 5 mg ≥ 95% EP11107_5 100 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: CB9L2

Molecular Weight: 1084.50

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CD20 188-196 (HLA-A*02:01) SLFLGILSV 1 mg ≥ 95% EP07888_1 50 EUR Add to cart


SLFLGILSV is a linear peptidic epitope (epitope ID140742) studied as part of B-lymphocyte antigen CD20 from Homo sapiens (human), tested in T cell assays

CD20 188-196 (HLA-A*02:01) SLFLGILSV for stimulation of T-cells. Single peptide (SLFLGILSV) for stimulation of human CD20 (188-196)-specific CD8+ T-cells.

Allele: A*02:01
Class: Class I
Antigen: CD20
Antigen Species: Human
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Cancer

other name: MS4A1 188-196 (HLA-A*02:01)

Molecular Weight: 948.18

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CD20 188-196 (HLA-A*02:01) SLFLGILSV 5 mg ≥ 95% EP07888_5 100 EUR Add to cart


SLFLGILSV is a linear peptidic epitope (epitope ID140742) studied as part of B-lymphocyte antigen CD20 from Homo sapiens (human), tested in T cell assays

CD20 188-196 (HLA-A*02:01) SLFLGILSV for stimulation of T-cells. Single peptide (SLFLGILSV) for stimulation of human CD20 (188-196)-specific CD8+ T-cells.

Allele: A*02:01
Class: Class I
Antigen: CD20
Antigen Species: Human
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Cancer

other name: MS4A1 188-196 (HLA-A*02:01)

Molecular Weight: 948.18

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CD22 antigen (HLA-A*02:01) PLSEGPHSL 1 mg ≥ 95% EP07885_1 50 EUR Add to cart


Antigen Peptide CD antigen HLA- A*0201 (PLSEGPHSL) for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays

Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Cancer

Molecular Weight: 936.04

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CD22 antigen (HLA-A*02:01) PLSEGPHSL 5 mg ≥ 95% EP07885_5 100 EUR Add to cart


Antigen Peptide CD antigen HLA- A*0201 (PLSEGPHSL) for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays

Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Cancer

Molecular Weight: 936.04

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CD22 antigen 173-181 (HLA-A*02:01) QLQWLLEGV 1 mg ≥ 95% EP07883_1 50 EUR Add to cart


CD22 antigen(173-181) peptide QLQWLLEGV (HLA- A*0201) for stimulation of T-cells. Single peptide (QLQWLLEGV) for stimulation of human CD22 antigen(173-181)-specific CD8+ T-cells.

Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Cancer

Molecular Weight: 1085.28

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CD22 antigen 173-181 (HLA-A*02:01) QLQWLLEGV 5 mg ≥ 95% EP07883_5 100 EUR Add to cart


CD22 antigen(173-181) peptide QLQWLLEGV (HLA- A*0201) for stimulation of T-cells. Single peptide (QLQWLLEGV) for stimulation of human CD22 antigen(173-181)-specific CD8+ T-cells.

Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Cancer

Molecular Weight: 1085.28

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CD22 antigen 459-467 (HLA-A*02:01) SLPYHSQKL 1 mg ≥ 95% EP07884_1 50 EUR Add to cart


D22 antigen(459-467) peptide SLPYHSQKL (HLA- A*0201) for stimulation of T-cells. Single peptide (SLPYHSQKL) for stimulation of human CD22 antigen(459-467)-specific CD8+ T-cells.

Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Cancer

Molecular Weight: 1072.23

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CD22 antigen 459-467 (HLA-A*02:01) SLPYHSQKL 5 mg ≥ 95% EP07884_5 100 EUR Add to cart


D22 antigen(459-467) peptide SLPYHSQKL (HLA- A*0201) for stimulation of T-cells. Single peptide (SLPYHSQKL) for stimulation of human CD22 antigen(459-467)-specific CD8+ T-cells.

Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Cancer

Molecular Weight: 1072.23

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CD22-4 371-379 (HLA-A*02:01) RLLGKESQL 1 mg ≥ 95% EP07909_1 50 EUR Add to cart


SARS-CoV-2 peptide LLLDRLNQL (HLA-A*0201) for stimulation of T-cells. Single peptide (LLLDRLNQL) for stimulation of human SARS-CoV-2-specific CD8+ T-cells.

Molecular Weight: 1097.33

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CD22-4 371-379 (HLA-A*02:01) RLLGKESQL 5 mg ≥ 95% EP07909_5 100 EUR Add to cart


SARS-CoV-2 peptide LLLDRLNQL (HLA-A*0201) for stimulation of T-cells. Single peptide (LLLDRLNQL) for stimulation of human SARS-CoV-2-specific CD8+ T-cells.

Molecular Weight: 1097.33

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CD33 65-73 (HLA-A*02:01) (65Y66L) YLISGDSPV 1 mg ≥ 95% EP11108_1 50 EUR Add to cart


YLISGDSPV is a linear peptidic epitope (epitope ID74719), tested in T cell assays and MHC ligand assay

Allele: A*02:01
Class: Class I
Antigen: CD33
Antigen Species: Human

Molecular Weight: 950.07

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CD33 65-73 (HLA-A*02:01) (65Y66L) YLISGDSPV 5 mg ≥ 95% EP11108_5 100 EUR Add to cart


YLISGDSPV is a linear peptidic epitope (epitope ID74719), tested in T cell assays and MHC ligand assay

Allele: A*02:01
Class: Class I
Antigen: CD33
Antigen Species: Human

Molecular Weight: 950.07

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CD59 glycoprotein precursor 106-114 (HLA-A*02:01) SLSEKTVLL 1 mg ≥ 95% EP11109_1 50 EUR Add to cart


SLSEKTVLL is a linear peptidic epitope (epitope ID 59453) studied as part of CD59 glycoprotein from Homo sapiens (human). This epitope has been studied for immune reactivity and was tested in T cell assay as well as MHC ligand assays

Allele: A*02:01
Class: Class I
Antigen: CD59
Antigen Species: Human

Molecular Weight: 989.18

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CD59 glycoprotein precursor 106-114 (HLA-A*02:01) SLSEKTVLL 5 mg ≥ 95% EP11109_5 100 EUR Add to cart


SLSEKTVLL is a linear peptidic epitope (epitope ID 59453) studied as part of CD59 glycoprotein from Homo sapiens (human). This epitope has been studied for immune reactivity and was tested in T cell assay as well as MHC ligand assays

Allele: A*02:01
Class: Class I
Antigen: CD59
Antigen Species: Human

Molecular Weight: 989.18

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CD79b 52-60 (HLA-A*02:01) TLKDGIIMI 1 mg ≥ 95% EP07910_1 50 EUR Add to cart


Antigen Peptide CD antigen HLA-A*0203 (TLKDGIIMI) for stimulation of antigen-specific T cells in T cell assays

Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Cancer

Molecular Weight: 1003.27

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CD79b 52-60 (HLA-A*02:01) TLKDGIIMI 5 mg ≥ 95% EP07910_5 100 EUR Add to cart


Antigen Peptide CD antigen HLA-A*0203 (TLKDGIIMI) for stimulation of antigen-specific T cells in T cell assays

Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Cancer

Molecular Weight: 1003.27

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CDH3 807-816 (HLA-A*24:02) DYLNEWGSRF 1 mg ≥ 95% EP11377_1 50 EUR Add to cart


YLNEWGSRF is a linear peptidic epitope (epitope ID477138) studied as part of Cadherin-3 from Homo sapiens (human), tested in MHC ligand assays

Allele: A*24:02
Class: Class I
Antigen: CDH3
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

other name: p-Cadherin 807-816 (HLA-A*24:02)

Molecular Weight: 1171.29

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CDH3 807-816 (HLA-A*24:02) DYLNEWGSRF 5 mg ≥ 95% EP11377_5 100 EUR Add to cart


YLNEWGSRF is a linear peptidic epitope (epitope ID477138) studied as part of Cadherin-3 from Homo sapiens (human), tested in MHC ligand assays

Allele: A*24:02
Class: Class I
Antigen: CDH3
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

other name: p-Cadherin 807-816 (HLA-A*24:02)

Molecular Weight: 1171.29

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CEA 605-613 (HLA-A*02:01) YLSGANLNL 1 mg ≥ 95% EP07878_1 50 EUR Add to cart


YLSGANLNL is a linear peptidic epitope (epitope ID74915) studied as part of Carcinoembryonic antigen-related cell adhesion molecule 5 from Homo sapiens (human) and Protein X from Hepatitis B virus (Human hepatitis B virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays.

Allele: A*02:01
Class: Class I
Antigen: CEA
Antigen Species: Human
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Cancer

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CEA 605-613 (HLA-A*02:01) YLSGANLNL 5 mg ≥ 95% EP07878_5 100 EUR Add to cart


YLSGANLNL is a linear peptidic epitope (epitope ID74915) studied as part of Carcinoembryonic antigen-related cell adhesion molecule 5 from Homo sapiens (human) and Protein X from Hepatitis B virus (Human hepatitis B virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays.

Allele: A*02:01
Class: Class I
Antigen: CEA
Antigen Species: Human
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Cancer

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CEA 605-613 mutant (HLA-A*02:01) 610D YLSGADLNL 1 mg ≥ 95% EP11112_1 50 EUR Add to cart


other name: Carcinoembryonic antigen (CEA)-derived peptide CEA-610D

Allele: A*02:01
Class: Class I
Antigen: CEA
Antigen Species: Human

Molecular Weight: 965.08

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CEA 605-613 mutant (HLA-A*02:01) 610D YLSGADLNL 5 mg ≥ 95% EP11112_5 100 EUR Add to cart


other name: Carcinoembryonic antigen (CEA)-derived peptide CEA-610D

Allele: A*02:01
Class: Class I
Antigen: CEA
Antigen Species: Human

Molecular Weight: 965.08

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CEA 652-660 (HLA-A*24:02) TYACFVSNL 1 mg ≥ 95% EP11111_1 50 EUR Add to cart


Carcinogenic Embryonic Antigen (CEA) 652-660 is a linear peptidic epitope (epitope ID 67308) studied as part of Carcinoembryonic antigen-related cell adhesion molecule 5 from Homo sapiens (human). This epitope has been studied for immune reactivity snd was tested in T cell assays as well as MHC ligand assay

Allele: A*24:02
Class: Class I
Antigen: CEA
Antigen Species: Human

Molecular Formula: C46H68N10O14S
Molecular Weight: 1017.18

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CEA 652-660 (HLA-A*24:02) TYACFVSNL 5 mg ≥ 95% EP11111_5 100 EUR Add to cart


Carcinogenic Embryonic Antigen (CEA) 652-660 is a linear peptidic epitope (epitope ID 67308) studied as part of Carcinoembryonic antigen-related cell adhesion molecule 5 from Homo sapiens (human). This epitope has been studied for immune reactivity snd was tested in T cell assays as well as MHC ligand assay

Allele: A*24:02
Class: Class I
Antigen: CEA
Antigen Species: Human

Molecular Formula: C46H68N10O14S
Molecular Weight: 1017.18

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CEA 694-702 (HLA-A*02:01) GVLVGVALI 1 mg ≥ 95% EP11110_1 50 EUR Add to cart


GVLVGVALI is a linear peptidic epitope (epitope ID137754) studied as part of Carcinoembryonic antigen-related cell adhesion molecule 5 from Homo sapiens (human)., tested in T cell assay

Allele: A*02:01
Class: Class I
Antigen: Carcinogenic Embryonic Antigen (CEA)
Antigen Species: Human

other name: Carcinogenic Embryonic Antigen (694-702)

Molecular Weight: 840.08

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CEA 694-702 (HLA-A*02:01) GVLVGVALI 5 mg ≥ 95% EP11110_5 100 EUR Add to cart


GVLVGVALI is a linear peptidic epitope (epitope ID137754) studied as part of Carcinoembryonic antigen-related cell adhesion molecule 5 from Homo sapiens (human)., tested in T cell assay

Allele: A*02:01
Class: Class I
Antigen: Carcinogenic Embryonic Antigen (CEA)
Antigen Species: Human

other name: Carcinogenic Embryonic Antigen (694-702)

Molecular Weight: 840.08

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CEACAM 185-193 (HLA-B*07:02) LPVSPRLQL 1 mg ≥ 95% EP11113_1 50 EUR Add to cart


Allele: B*07:02
Class: Class I
Antigen: CEACAM1
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1022.27

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CEACAM 185-193 (HLA-B*07:02) LPVSPRLQL 5 mg ≥ 95% EP11113_5 100 EUR Add to cart


Allele: B*07:02
Class: Class I
Antigen: CEACAM1
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1022.27

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Cecropin A (1-7)-Melittin A (2-9) KWKLFKKIGAVLKVL-NH2 1 mg ≥95% EP14421_1 50 EUR Add to cart


Cecropin A (1-7)-Melittin A (2-9) amide, also referred to as CAMEL0, is a synthetic hybrid peptide that is composed of portions of the naturally occurring antibiotic peptide cecropin A and melittin. CAMEL0 shows a better antimicrobial activity than the native molecules, but lacks the hemolytic properties of melittin. Studies revealed that the range of its antimicrobial activity is not only restricted to aerobic microorganisms but also included several gram-negative and gram-positive anaerobic microorganisms. Through its ascertained broad spectrum of antibiotic activity, this hybrid peptide may also represent an effective substitute for ciprofloxacin in the treatment of anthrax infections.

KWKLFKKIGAVLKVL obtained by combining residues 1-7 of cecropin and residues 2-9 of melittin, it is an antimicrobial peptide

other name: CM15, CAMEL0, Cecropin A (1-8)-Melittin A (3-9) amide, Cecropin A-melittin hybrid peptide [CA(1-7)M(2-9)NH2]
Molecular Formula: C89H152N22O15
Molecular Weight: 1770.33

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Cecropin A (1-7)-Melittin A (2-9) KWKLFKKIGAVLKVL-NH2 5 mg ≥95% EP14421_5 150 EUR Add to cart


Cecropin A (1-7)-Melittin A (2-9) amide, also referred to as CAMEL0, is a synthetic hybrid peptide that is composed of portions of the naturally occurring antibiotic peptide cecropin A and melittin. CAMEL0 shows a better antimicrobial activity than the native molecules, but lacks the hemolytic properties of melittin. Studies revealed that the range of its antimicrobial activity is not only restricted to aerobic microorganisms but also included several gram-negative and gram-positive anaerobic microorganisms. Through its ascertained broad spectrum of antibiotic activity, this hybrid peptide may also represent an effective substitute for ciprofloxacin in the treatment of anthrax infections.

KWKLFKKIGAVLKVL obtained by combining residues 1-7 of cecropin and residues 2-9 of melittin, it is an antimicrobial peptide

other name: CM15, CAMEL0, Cecropin A (1-8)-Melittin A (3-9) amide, Cecropin A-melittin hybrid peptide [CA(1-7)M(2-9)NH2]
Molecular Formula: C89H152N22O15
Molecular Weight: 1770.33

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Chlamydia trachomatis MOMP 258-266 (HLA-A*02:01) RLNMFTPYI 1 mg ≥ 95% EP11114_1 50 EUR Add to cart


RLNMFTPYI is a linear peptidic epitope (epitope ID54686) studied as part of Chlamydia trachomatis and Major outer membrane porin, serovar D from Chlamydia trachomatis. This epitope has been studied for immune reactivity in publication(s), tested in T cell assays and MHC ligand assay

Allele: A*02:01
Class: Class I
Antigen: MOMP
Antigen Species: Chlamydia trachomatis

Molecular Weight: 1154.41

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Chlamydia trachomatis MOMP 258-266 (HLA-A*02:01) RLNMFTPYI 5 mg ≥ 95% EP11114_5 100 EUR Add to cart


RLNMFTPYI is a linear peptidic epitope (epitope ID54686) studied as part of Chlamydia trachomatis and Major outer membrane porin, serovar D from Chlamydia trachomatis. This epitope has been studied for immune reactivity in publication(s), tested in T cell assays and MHC ligand assay

Allele: A*02:01
Class: Class I
Antigen: MOMP
Antigen Species: Chlamydia trachomatis

Molecular Weight: 1154.41

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Chondromodulin-I 319-327 (HLA-A*02:01) VIMPCSWWV 1 mg ≥ 95% EP11115_1 50 EUR Add to cart


Molecular Weight: 1120.41

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Chondromodulin-I 319-327 (HLA-A*02:01) VIMPCSWWV 5 mg ≥ 95% EP11115_5 100 EUR Add to cart


Molecular Weight: 1120.41

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CKS2 11-19  (HLA-C0702) KYFDEHYEY 1 mg ≥95% EP13049_1 50 EUR Add to cart


KYFDEHYEY is a linear peptidic epitope studied as part of Cyclin-dependent kinases regulatory subunit 2 from Homo sapiens (human) and Other Mus musculus (mouse) protein from Mus musculus (mouse). This epitope has been studied for immune reactivity, tested in MHC ligand assays.

Molecular Weight: 1293.36

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CKS2 11-19  (HLA-C0702) KYFDEHYEY 5 mg ≥95% EP13049_5 100 EUR Add to cart


KYFDEHYEY is a linear peptidic epitope studied as part of Cyclin-dependent kinases regulatory subunit 2 from Homo sapiens (human) and Other Mus musculus (mouse) protein from Mus musculus (mouse). This epitope has been studied for immune reactivity, tested in MHC ligand assays.

Molecular Weight: 1293.36

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV IE-1 199-207 (HLA-B*08:01) ELRRKMMYM 1 mg ≥ 95% EP11120_1 50 EUR Add to cart


ELRRKMMYM is a linear peptidic epitope (epitope ID 13133) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivit, tested in Tcell assays and MHC ligand assays.

Allele: B*08:01
Class: Class I
Antigen: CMV IE1
Antigen Species: CMV
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Infection, Control, Cancer, TORCH, Infectious mononucleosis, CMV hepatitis, Retinitis, Colitis, Pneumonitis, Esophagitis, AIDS, Cancer chemotherapy, Transplantation

Molecular Weight: 1257.61

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV IE-1 199-207 (HLA-B*08:01) ELRRKMMYM 5 mg ≥ 95% EP11120_5 100 EUR Add to cart


ELRRKMMYM is a linear peptidic epitope (epitope ID 13133) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivit, tested in Tcell assays and MHC ligand assays.

Allele: B*08:01
Class: Class I
Antigen: CMV IE1
Antigen Species: CMV
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Infection, Control, Cancer, TORCH, Infectious mononucleosis, CMV hepatitis, Retinitis, Colitis, Pneumonitis, Esophagitis, AIDS, Cancer chemotherapy, Transplantation

Molecular Weight: 1257.61

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV IE-1 199-207 mutant (HLA-B*08:01) 201K, 205I ELKRKMIYM 1 mg ≥ 95% EP11118_1 50 EUR Add to cart


ELKRKMIYM is a linear peptidic epitope (epitope ID 13133) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in Tcell assays and MHC ligand assays.

Allele: B*08:01
Class: Class I
Antigen: CMV IE1
Antigen Species: CMV
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1211.55

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV IE-1 199-207 mutant (HLA-B*08:01) 201K, 205I ELKRKMIYM 5 mg ≥ 95% EP11118_5 100 EUR Add to cart


ELKRKMIYM is a linear peptidic epitope (epitope ID 13133) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in Tcell assays and MHC ligand assays.

Allele: B*08:01
Class: Class I
Antigen: CMV IE1
Antigen Species: CMV
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1211.55

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV IE-1 248-256 (HLA-A*24:02) AYAQKIFKI 1 mg ≥ 95% EP11117_1 50 EUR Add to cart


AYAQKIFKI is a linear peptidic epitope (epitope ID140986) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1081.32

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV IE-1 248-256 (HLA-A*24:02) AYAQKIFKI 5 mg ≥ 95% EP11117_5 100 EUR Add to cart


AYAQKIFKI is a linear peptidic epitope (epitope ID140986) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1081.32

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV IE-1 378-389 (HLA-B18) SDEEEAIVAYTL 1 mg ≥95% EP08624_1 80 EUR Add to cart


HLA-B18-restricted epitope from Cytomegalovirus (378-389)

other name: CEF24, Cytomegalovirus 378-389

Molecular Weight: 1339.43

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV IE-1 378-389 (HLA-B18) SDEEEAIVAYTL 5 mg ≥95% EP08624_5 160 EUR Add to cart


HLA-B18-restricted epitope from Cytomegalovirus (378-389)

other name: CEF24, Cytomegalovirus 378-389

Molecular Weight: 1339.43

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV IE1 51-59 (HLA-B*08:01) ELNRKMIYM 1 mg ≥ 95% EP11119_1 50 EUR Add to cart


CMV IE1-derived peptide of ELNRKMIYM covering 51-59 and B*08:01 molecule is a linear peptidic epitope (epitope ID 240792) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus), tested in T cell assays and MHC ligand assays.

Allele: B*08:01
Class: Class I
Antigen: CMV IE1
Antigen Species: CMV
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1197.49

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV IE1 51-59 (HLA-B*08:01) ELNRKMIYM 5 mg ≥ 95% EP11119_5 100 EUR Add to cart


CMV IE1-derived peptide of ELNRKMIYM covering 51-59 and B*08:01 molecule is a linear peptidic epitope (epitope ID 240792) studied as part of 55 kDa immediate-early protein 1 from Human herpesvirus 5 (Human cytomegalovirus), tested in T cell assays and MHC ligand assays.

Allele: B*08:01
Class: Class I
Antigen: CMV IE1
Antigen Species: CMV
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1197.49

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV pp50 245-253 (HLA-A*01:01) VTEHDTLLY 1 mg ≥ 95% EP05819_1 50 EUR Add to cart


VTEHDTLLY is a linear peptidic epitope (epitope ID71290) studied as part of DNA polymerase processivity factor from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay

Allele: B*01:01
Class: Class I
Antigen: CMV pp50
Antigen Species: CMV
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Infection, Control, Cancer, TORCH, Infectious mononucleosis, CMV hepatitis, Retinitis, Colitis, Pneumonitis, Esophagitis, AIDS, Cancer chemotherapy, Transplantation

Molecular Weight: 1090.21

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV pp50 245-253 (HLA-A*01:01) VTEHDTLLY 5 mg ≥ 95% EP05819_5 100 EUR Add to cart


VTEHDTLLY is a linear peptidic epitope (epitope ID71290) studied as part of DNA polymerase processivity factor from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay

Allele: B*01:01
Class: Class I
Antigen: CMV pp50
Antigen Species: CMV
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Infection, Control, Cancer, TORCH, Infectious mononucleosis, CMV hepatitis, Retinitis, Colitis, Pneumonitis, Esophagitis, AIDS, Cancer chemotherapy, Transplantation

Molecular Weight: 1090.21

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV pp65 (HLA-C*04:01) QYDPVAALFL 1 mg ≥ 95% EP07966_1 50 EUR Add to cart


Molecular Weight: 1136.32

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV pp65 (HLA-C*04:01) QYDPVAALFL 5 mg ≥ 95% EP07966_5 100 EUR Add to cart


Molecular Weight: 1136.32

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV pp65 16-24 (HLA-A*11:01) GPISGHVLK 1 mg ≥ 95% EP06165_1 50 EUR Add to cart


CMV pp65(16-24) peptide GPISGHVLK (HLA-A*1101) for stimulation of human CMV pp65 (16-24)-specific CD8+ T-cells.

Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Control;Infectious mononucleosis;Opportunistic infections

Molecular Weight: 907.08

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV pp65 16-24 (HLA-A*11:01) GPISGHVLK 5 mg ≥ 95% EP06165_5 100 EUR Add to cart


CMV pp65(16-24) peptide GPISGHVLK (HLA-A*1101) for stimulation of human CMV pp65 (16-24)-specific CD8+ T-cells.

Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Control;Infectious mononucleosis;Opportunistic infections

Molecular Weight: 907.08

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV pp65 265-275 (HLA-B*07:02) RPHERNGFTVL 1 mg ≥ 95% EP07911_1 50 EUR Add to cart


RPHERNGFTVL is a linear peptidic epitope (epitope ID55170) studied as part of 65 kDa phosphoprotein from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Allele: B*07:02
Class: Class I
Antigen: CMV pp65
Antigen Species: CMV
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Infection, Control, Cancer, TORCH, Infectious mononucleosis, CMV hepatitis, Retinitis, Colitis, Pneumonitis, Esophagitis, AIDS, Cancer chemotherapy, Transplantation

Molecular Weight: 1325.50

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free


CMV pp65 265-275 (HLA-B*07:02) RPHERNGFTVL 5 mg ≥ 95% EP07911_5 100 EUR Add to cart


RPHERNGFTVL is a linear peptidic epitope (epitope ID55170) studied as part of 65 kDa phosphoprotein from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Allele: B*07:02
Class: Class I
Antigen: CMV pp65
Antigen Species: CMV
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Infection, Control, Cancer, TORCH, Infectious mononucleosis, CMV hepatitis, Retinitis, Colitis, Pneumonitis, Esophagitis, AIDS, Cancer chemotherapy, Transplantation

Molecular Weight: 1325.50

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV pp65 417 – 426 (HLA-B*07:02) TPRVTGGGAM 1 mg ≥ 95% EP05818_1 100 EUR Add to cart


Antigen Peptide CMV pp65 417 – 426 (HLA-B*07:02) TPRVTGGGAM for stimulation of antigen-specific T cells in T cell assays

TPRVTGGGAM is a linear peptidic epitope (epitope ID65748) studied as part of 65 kDa phosphoprotein from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Allele: B*07:02
Class: Class I
Antigen: CMV pp65
Antigen Species: CMV
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Infection, Control, Cancer, TORCH, Infectious mononucleosis, CMV hepatitis, Retinitis, Colitis, Pneumonitis, Esophagitis, AIDS, Cancer chemotherapy, Transplantation

Molecular Weight: 946.10

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV pp65 417 – 426 (HLA-B*07:02) TPRVTGGGAM 5 mg ≥ 95% EP05818_5 170 EUR Add to cart


Antigen Peptide CMV pp65 417 – 426 (HLA-B*07:02) TPRVTGGGAM for stimulation of antigen-specific T cells in T cell assays

TPRVTGGGAM is a linear peptidic epitope (epitope ID65748) studied as part of 65 kDa phosphoprotein from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Allele: B*07:02
Class: Class I
Antigen: CMV pp65
Antigen Species: CMV
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Infection, Control, Cancer, TORCH, Infectious mononucleosis, CMV hepatitis, Retinitis, Colitis, Pneumonitis, Esophagitis, AIDS, Cancer chemotherapy, Transplantation

Molecular Weight: 946.10

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV pp65 417-426 (HLA-B*07:02), amide TPRVTGGGAM-NH2 1 mg ≥95% EP01897_1 100 EUR Add to cart


Molecular Weight: 945.09


Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV pp65 417-426 (HLA-B*07:02), amide TPRVTGGGAM-NH2 5 mg ≥95% EP01897_5 170 EUR Add to cart


Molecular Weight: 945.09

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV pp65 495-503 (HLA-A*02:01) NLVPMVATV 1 mg ≥ 95% EP04509_1 50 EUR Add to cart


NLVPMVATV is a linear peptidic epitope (epitope ID44920) studied as part of 65 kDa phosphoprotein from Human herpesvirus 5 (Human cytomegalovirus) and Unidentified protein from Unidentified. This epitope has been studied for immune reactivity, tested in T cell assays, B cell assays and MHC ligand assays

Allele: A*02:01
Class: Class I
Antigen: CMV pp65
Antigen Species: CMV
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Infection, Control, Cancer, TORCH, Infectious mononucleosis, CMV hepatitis, Retinitis, Colitis, Pneumonitis, Esophagitis, AIDS, Cancer chemotherapy, Transplantation

Molecular Weight: 943.18

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV pp65 495-503 (HLA-A*02:01) NLVPMVATV 5 mg ≥ 95% EP04509_5 100 EUR Add to cart


NLVPMVATV is a linear peptidic epitope (epitope ID44920) studied as part of 65 kDa phosphoprotein from Human herpesvirus 5 (Human cytomegalovirus) and Unidentified protein from Unidentified. This epitope has been studied for immune reactivity, tested in T cell assays, B cell assays and MHC ligand assays

Allele: A*02:01
Class: Class I
Antigen: CMV pp65
Antigen Species: CMV
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Infection, Control, Cancer, TORCH, Infectious mononucleosis, CMV hepatitis, Retinitis, Colitis, Pneumonitis, Esophagitis, AIDS, Cancer chemotherapy, Transplantation

Molecular Weight: 943.18

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV UL138 (HLA-B*35:01) LPLNVGLPIIGVM 1 mg ≥ 95% EP11123_1 100 EUR Add to cart


LPLNVGLPIIGVM is a linear peptidic epitope (epitope ID 188912) studied as part of Protein UL138 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay

Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1335.73

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV UL138 (HLA-B*35:01) LPLNVGLPIIGVM 5 mg ≥ 95% EP11123_5 200 EUR Add to cart


LPLNVGLPIIGVM is a linear peptidic epitope (epitope ID 188912) studied as part of Protein UL138 from Human herpesvirus 5 (Human cytomegalovirus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay

Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1335.73

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV UL40 15-23 (HLA-E) VMAPRTLIL 1 mg ≥ 95% EP06244_1 50 EUR Add to cart


VMAPRTLIL is a linear peptidic epitope (epitope ID69921) studied as part of HLA class I histocompatibility antigen, Cw-14 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-5 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-2 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-4 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-3 alpha chain from Homo sapiens (human), Protein UL40 from Human herpesvirus 5 (Human cytomegalovirus), HLA class I histocompatibility antigen, Cw-8 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-12 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-16 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-17 alpha chain from Homo sapiens (human) and Unidentified protein from Unidentified. This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Allele: HLA-E
Class: Class I
Antigen: CMV UL40
Antigen Species: CMV

Molecular Weight: 1013.32

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CMV UL40 15-23 (HLA-E) VMAPRTLIL 5 mg ≥ 95% EP06244_5 100 EUR Add to cart


VMAPRTLIL is a linear peptidic epitope (epitope ID69921) studied as part of HLA class I histocompatibility antigen, Cw-14 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-5 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-2 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-4 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-3 alpha chain from Homo sapiens (human), Protein UL40 from Human herpesvirus 5 (Human cytomegalovirus), HLA class I histocompatibility antigen, Cw-8 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-12 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-16 alpha chain from Homo sapiens (human), HLA class I histocompatibility antigen, Cw-17 alpha chain from Homo sapiens (human) and Unidentified protein from Unidentified. This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Allele: HLA-E
Class: Class I
Antigen: CMV UL40
Antigen Species: CMV

Molecular Weight: 1013.32

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CPIM 399–406 (H-2 Kb) HILIYSDV 1 mg ≥95% EP13089_1 50 EUR Add to cart


HILIYSDV is a linear peptidic epitope studied as part of Myosin-binding protein C, fast-type from Mus musculus (mouse), tested in T cell assay and MHC ligand assay.

Allele: H-2Kb
Class: Class I
Antigen: MYBPC2
Antigen Species: Human

Molecular Weight: 959.12

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CPIM 399–406 (H-2 Kb) HILIYSDV 5 mg ≥95% EP13089_5 100 EUR Add to cart


HILIYSDV is a linear peptidic epitope studied as part of Myosin-binding protein C, fast-type from Mus musculus (mouse), tested in T cell assay and MHC ligand assay.

Allele: H-2Kb
Class: Class I
Antigen: MYBPC2
Antigen Species: Human

Molecular Weight: 959.12

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CRGDS CRGDS 1 mg ≥ 95% EP08010_1 50 EUR Add to cart


GRGDS forms the cell-binding domain of a glycoprotein, Osteopontin (OPN) . Although the native form of OPN is active in cell attachment assays, it has been observed that thrombin cleavage of OPN causes substantial enhancement of it's attachment properties. This cleavage occurs within residues of the GRGDS sequence raising the possibility of thrombin-cleavage further activating OPN by allowing greater accessibility of the GRGDS domain to cell surface receptors. GRGDS synthetic peptide also mimics the cellular binding site of many adhesive proteins in the extracellular matrix and causes rounding and detachment of spread cells. It induces dissociation of alpha-actinin and vinculin from the sites of focal contacts.

Gly-Arg-Gly-Asp-Ser peptide sequence is identical to the cell-binding region of fibronectin protein. Arg-Gly-Asp (RGD) region is found in various proteins, and is crucial for facilitating cell-adhesive activity.

Molecular Weight: 490.48

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CRGDS CRGDS 5 mg ≥ 95% EP08010_5 100 EUR Add to cart


GRGDS forms the cell-binding domain of a glycoprotein, Osteopontin (OPN) . Although the native form of OPN is active in cell attachment assays, it has been observed that thrombin cleavage of OPN causes substantial enhancement of it's attachment properties. This cleavage occurs within residues of the GRGDS sequence raising the possibility of thrombin-cleavage further activating OPN by allowing greater accessibility of the GRGDS domain to cell surface receptors. GRGDS synthetic peptide also mimics the cellular binding site of many adhesive proteins in the extracellular matrix and causes rounding and detachment of spread cells. It induces dissociation of alpha-actinin and vinculin from the sites of focal contacts.

Gly-Arg-Gly-Asp-Ser peptide sequence is identical to the cell-binding region of fibronectin protein. Arg-Gly-Asp (RGD) region is found in various proteins, and is crucial for facilitating cell-adhesive activity.

Molecular Weight: 490.48

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Cyclin A1 227-235 (HLA-A*02:01) FLDRFLSCM 1 mg ≥ 95% EP07912_1 50 EUR Add to cart


Single peptide (FLDRFLSCM) for stimulation of human CyclinA1(227-235)-specific CD8+T cells

Molecular Weight: 1131.39

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Cyclin A1 227-235 (HLA-A*02:01) FLDRFLSCM 5 mg ≥ 95% EP07912_5 100 EUR Add to cart


Single peptide (FLDRFLSCM) for stimulation of human CyclinA1(227-235)-specific CD8+T cells

Molecular Weight: 1131.39

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

CyLoP-1 CRWRWKCCKK 1 mg ≥ 95% EP09848_1 120 EUR Add to cart


CyLoP-1 is a cysteine-rich cell-penetrating peptide derived from nuclear localization sequence of snake toxin, crotamine. The peptide has shown cytoplasmic uptake in mammalian cells at lower concentrations. In the present study, the cell-penetrating and antimicrobial activity of the peptide has been studied by employing mammalian cells, plant cells as well as bacterial and fungal pathogens. The study shows that the peptide acts as an effective CPP and a cargo-delivery vector for not only mammalian cells but also for plant cells. Besides this, the peptide also possesses antimicrobial activity against representative pathogens tested. It is shown to be effective in killing methicillin-resistant Staphylococcus aureus. We have observed that the presence of cysteine residues in the peptide play a major role in conferring cell-penetrating as well as antimicrobial activity to the peptide since there is a significant decline in these activities when cysteine residues are replaced with serine residues. Our findings are significant for the proposition that CyLoP-1 is an efficient membrane-active peptide with both cell-penetrating and antimicrobial activity. Hence, it can be further evaluated for its application in the field of drug-delivery, plant biotechnology and as a peptide-antibiotic.

Molecular Weight: 1396.76

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free


CyLoP-1 CRWRWKCCKK 5 mg ≥ 95% EP09848_5 150 EUR Add to cart


CyLoP-1 is a cysteine-rich cell-penetrating peptide derived from nuclear localization sequence of snake toxin, crotamine. The peptide has shown cytoplasmic uptake in mammalian cells at lower concentrations. In the present study, the cell-penetrating and antimicrobial activity of the peptide has been studied by employing mammalian cells, plant cells as well as bacterial and fungal pathogens. The study shows that the peptide acts as an effective CPP and a cargo-delivery vector for not only mammalian cells but also for plant cells. Besides this, the peptide also possesses antimicrobial activity against representative pathogens tested. It is shown to be effective in killing methicillin-resistant Staphylococcus aureus. We have observed that the presence of cysteine residues in the peptide play a major role in conferring cell-penetrating as well as antimicrobial activity to the peptide since there is a significant decline in these activities when cysteine residues are replaced with serine residues. Our findings are significant for the proposition that CyLoP-1 is an efficient membrane-active peptide with both cell-penetrating and antimicrobial activity. Hence, it can be further evaluated for its application in the field of drug-delivery, plant biotechnology and as a peptide-antibiotic.

Molecular Weight: 1396.76

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Cytochrome p450 1B1 239-248 (HLA-A*02:01) SLVDVMPWL 1 mg ≥ 95% EP11124_1 50 EUR Add to cart


Molecular Weight: 1059.30

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Cytochrome p450 1B1 239-248 (HLA-A*02:01) SLVDVMPWL 5 mg ≥ 95% EP11124_5 100 EUR Add to cart


Molecular Weight: 1059.30

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

DEAD box RNA helicase (355–363) HLA-Cw*05:01 ITASRFKEL 1 mg ≥ 95% EP14505_1 50 EUR Add to cart


Molecular Weight: 1064.25

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

DEAD box RNA helicase (355–363) HLA-Cw*05:01 ITASRFKEL 5 mg ≥ 95% EP14505_5 100 EUR Add to cart


Molecular Weight: 1064.25

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

DEP DC1 294-302 (HLA-A*24:02) EYYELFVNI 1 mg ≥ 95% EP11125_1 50 EUR Add to cart


Allele: A*24:02
Class: Class I
Antigen: DEPDC1
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1189.34

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free


DEP DC1 294-302 (HLA-A*24:02) EYYELFVNI 5 mg ≥ 95% EP11125_5 100 EUR Add to cart


Allele: A*24:02
Class: Class I
Antigen: DEPDC1
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 1189.34

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Derp1 117–127 CQIYPPNVNKI 1 mg 95% EP11647_1 80 EUR Add to cart


CQIYPPNVNKI is a linear peptidic epitope (epitope ID242387) studied as part of Der p 1 from Dermatophagoides pteronyssinus (European house dust mite), tested in T cell assays

antigen name: Derp1
host organism: Mus musculus C57BL/6
mhc allele name: H2-IAb

Molecular Weight: 1288.54

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

Derp1 117–127 CQIYPPNVNKI 5 mg 95% EP11647_5 160 EUR Add to cart


CQIYPPNVNKI is a linear peptidic epitope (epitope ID242387) studied as part of Der p 1 from Dermatophagoides pteronyssinus (European house dust mite), tested in T cell assays

antigen name: Derp1
host organism: Mus musculus C57BL/6
mhc allele name: H2-IAb

Molecular Weight: 1288.54

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

DLK1 309-317 (HLA-A*02:01) ILGVLTSLV 1 mg ≥ 95% EP11126_1 50 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: DLK1
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 914.16

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

DLK1 309-317 (HLA-A*02:01) ILGVLTSLV 5 mg ≥ 95% EP11126_5 100 EUR Add to cart


Allele: A*02:01
Class: Class I
Antigen: DLK1
Antigen Species: Human
Application(s): Cellular immune response, Immune monitoring, T-cell assays, Immunohistochemistry
Indication(s)/Topic(s): AIDS, Autoimmune disease, Breast cancer, Cancer, Cancer chemotherapy, Control, Diabetes, Graft-vs-host disease, Hematopoetic system, Hepatitis, Infection, Malaria, Malignant genital cancers, Melanoma, Prostate cancer, Testis/ovary cancer, Tuberculosis, Transplantation, Vaccination, Wilms tumor 1

Molecular Weight: 914.16

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBNA 3a (596-604) SVRDRLARL 1 mg ≥ 95% EP10789_1 50 EUR Add to cart


This peptide represents an HLA-A2-restricted epitope of the Epstein-Barr virus nuclear antigen 3 (EBNA 3). EBNA 3 is a transcriptional regulatory protein that promotes B cell activation through the RBP-Jk pathway. This peptide is used in the study of immunotherapy for solid organ transplant patients.

Molecular Weight: 1085.28

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBNA 3a (596-604) SVRDRLARL 5 mg ≥ 95% EP10789_5 100 EUR Add to cart


This peptide represents an HLA-A2-restricted epitope of the Epstein-Barr virus nuclear antigen 3 (EBNA 3). EBNA 3 is a transcriptional regulatory protein that promotes B cell activation through the RBP-Jk pathway. This peptide is used in the study of immunotherapy for solid organ transplant patients.

Molecular Weight: 1085.28

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBNA-1 Protein (562-570) FMVFLQTHI 1 mg ≥95% EP04510_1 50 EUR Add to cart


The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalo virus). On infecting the B-lymphocyte, the linear virus genome circularizes and the virus subsequently persists within the cell as an episome. The virus can execute several distinct programs of gene expression which can be broadly categorized as being lytic cycle or latent cycle. The lytic cycle or productive infection results in staged expression of a host of viral proteins with the ultimate objective of producing infectious virions. Formally, this phase of infection does not inevitably lead to lysis of the host cell as EBV virions are produced by budding from the infected cell. The latent cycle (lysogenic) programs are those that do not result in production of virions.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBNA-1 Protein (562-570) FMVFLQTHI 5 mg ≥95% EP04510_5 100 EUR Add to cart


The Epstein-Barr virus (EBV), also called Human herpes virus 4 (HHV-4), is a virus of the herpes family (which includes Herpes simplex virus and Cytomegalo virus). On infecting the B-lymphocyte, the linear virus genome circularizes and the virus subsequently persists within the cell as an episome. The virus can execute several distinct programs of gene expression which can be broadly categorized as being lytic cycle or latent cycle. The lytic cycle or productive infection results in staged expression of a host of viral proteins with the ultimate objective of producing infectious virions. Formally, this phase of infection does not inevitably lead to lysis of the host cell as EBV virions are produced by budding from the infected cell. The latent cycle (lysogenic) programs are those that do not result in production of virions.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BALF-4 276–284 (HLA-A*02:01) FLDKGTYTL 1 mg ≥ 95% EP11237_1 50 EUR Add to cart


FLDKGTYTL is a linear peptidic epitope (epitope ID16548) studied as part of Envelope glycoprotein B from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Antigen Peptide EBV BALF-4 276–284 (HLA-A*02:01) FLDKGTYTL for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BALF-4 276–284 (HLA-A*02:01) FLDKGTYTL 5 mg ≥ 95% EP11237_5 100 EUR Add to cart


FLDKGTYTL is a linear peptidic epitope (epitope ID16548) studied as part of Envelope glycoprotein B from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Antigen Peptide EBV BALF-4 276–284 (HLA-A*02:01) FLDKGTYTL for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BMLF-1 280-288 (HLA-A*02:01) GLCTLVAML 1 mg ≥ 95% EP07604_1 50 EUR Add to cart


EBV peptide GLCTLVAML (HLA-A*0201) for stimulation of T-cells. Single peptide (GLCTLVAML) for stimulation of human EBV BMLF-1(280-288) CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allele.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BMLF-1 280-288 (HLA-A*02:01) GLCTLVAML 5 mg ≥ 95% EP07604_5 100 EUR Add to cart


EBV peptide GLCTLVAML (HLA-A*0201) for stimulation of T-cells. Single peptide (GLCTLVAML) for stimulation of human EBV BMLF-1(280-288) CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-A*0201 allele.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BMRF1 116-128 (HLA-B*07:02) RPQGGSRPEFVKL 1 mg ≥ 95% EP11138_1 100 EUR Add to cart


RPQGGSRPEFVKL is a linear peptidic epitope (epitope ID 55295) studied as part of DNA polymerase processivity factor BMRF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity and tested in T cell assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BMRF1 116-128 (HLA-B*07:02) RPQGGSRPEFVKL 5 mg ≥ 95% EP11138_5 200 EUR Add to cart


RPQGGSRPEFVKL is a linear peptidic epitope (epitope ID 55295) studied as part of DNA polymerase processivity factor BMRF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity and tested in T cell assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BMRF1 208-216 (HLA-A*02:01) TLDYKPLSV 1 mg ≥ 95% EP11127_1 50 EUR Add to cart


TLDYKPLSV is a linear peptidic epitope (epitope ID 64763) studied as part of DNA polymerase processivity factor BMRF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BMRF1 208-216 (HLA-A*02:01) TLDYKPLSV 5 mg ≥ 95% EP11127_5 100 EUR Add to cart


TLDYKPLSV is a linear peptidic epitope (epitope ID 64763) studied as part of DNA polymerase processivity factor BMRF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BRLF-1 148-156 (HLA-A*03:01) RVRAYTYSK 1 mg ≥ 95% EP11482_1 50 EUR Add to cart


HLA-A∗0301-restricted epitope from Epstein-Barr Virus , EBV BRLF-1 (148-156).

RVRAYTYSK is a linear peptidic epitope (epitope ID56390) studied as part of Replication and transcription activator from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

other name: CEF27, Epstein – Barr Virus BRLF – 1 lytic (148 – 156)

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BRLF-1 148-156 (HLA-A*03:01) RVRAYTYSK 5 mg ≥ 95% EP11482_5 100 EUR Add to cart


HLA-A∗0301-restricted epitope from Epstein-Barr Virus , EBV BRLF-1 (148-156).

RVRAYTYSK is a linear peptidic epitope (epitope ID56390) studied as part of Replication and transcription activator from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

other name: CEF27, Epstein – Barr Virus BRLF – 1 lytic (148 – 156)

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BRLF1 101-109 (HLA-A*29:02) IACPIVMRY 1 mg ≥ 95% EP11142_1 50 EUR Add to cart


Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BRLF1 101-109 (HLA-A*29:02) IACPIVMRY 5 mg ≥ 95% EP11142_5 100 EUR Add to cart


Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BRLF1 109–117 (HLA-A*02:01) YVLDHLIVV 1 mg ≥ 95% EP11139_1 50 EUR Add to cart


Antigen Peptide BRLF1 109–117 HLA-A*02:01 (YVLDHLIVV) for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays.
YVLDHLIVV is a linear peptidic epitope (epitope ID76333) studied as part of Replication and transcription activator from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity and tested in T cell assays as well as MHC ligand assay.

Allele: A*02:01
Class: Class I
Antigen: BRLF1
Antigen Species: EBV
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Autoimmune disease, Burkitt's lymphoma, Hodgkin's lymphoma, Nasopharyngeal carcinoma

Molecular Weight: 1070.31

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BRLF1 109–117 (HLA-A*02:01) YVLDHLIVV 5 mg ≥ 95% EP11139_5 100 EUR Add to cart


Antigen Peptide BRLF1 109–117 HLA-A*02:01 (YVLDHLIVV) for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays.
YVLDHLIVV is a linear peptidic epitope (epitope ID76333) studied as part of Replication and transcription activator from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity and tested in T cell assays as well as MHC ligand assay.

Allele: A*02:01
Class: Class I
Antigen: BRLF1
Antigen Species: EBV
Application(s): T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response
Indication(s)/Topic(s): Autoimmune disease, Burkitt's lymphoma, Hodgkin's lymphoma, Nasopharyngeal carcinoma

Molecular Weight: 1070.31

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BRLF1 134-142 (HLA-A*11:01) ATIGTAMYK 1 mg ≥ 95% EP11140_1 50 EUR Add to cart


HLA-A11 restricted epitope from Epstein-Barr Virus BRLF1 (134-142) is a linear peptidic epitope (epitope ID 5002) studied as part of Replication and transcription activator from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BRLF1 134-142 (HLA-A*11:01) ATIGTAMYK 5 mg ≥ 95% EP11140_5 100 EUR Add to cart


HLA-A11 restricted epitope from Epstein-Barr Virus BRLF1 (134-142) is a linear peptidic epitope (epitope ID 5002) studied as part of Replication and transcription activator from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assay

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BRLF1 28-37 (HLA-A*24:02) DYCNVLNKEF 1 mg ≥ 95% EP11141_1 50 EUR Add to cart


Antigen Peptide EBV BRLF1 28-37 (HLA-A*24:02) DYCNVLNKEF for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BRLF1 28-37 (HLA-A*24:02) DYCNVLNKEF 5 mg ≥ 95% EP11141_5 100 EUR Add to cart


Antigen Peptide EBV BRLF1 28-37 (HLA-A*24:02) DYCNVLNKEF for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BZLF-1 190-197 (HLA-B*08:01) RAKFKQLL 1 mg ≥ 95% EP07899_1 50 EUR Add to cart


Antigen peptide RAKFKQLL for stimulation of human EBV BZLF-1(190-197)-specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*0801 allele. RAKFKQLL is a linear peptidic epitope (epitope ID53128) studied as part of Trans-activator protein BZLF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BZLF-1 190-197 (HLA-B*08:01) RAKFKQLL 5 mg ≥ 95% EP07899_5 100 EUR Add to cart


Antigen peptide RAKFKQLL for stimulation of human EBV BZLF-1(190-197)-specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*0801 allele. RAKFKQLL is a linear peptidic epitope (epitope ID53128) studied as part of Trans-activator protein BZLF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BZLF-1 54-64 (HLA-B*35:01) EPLPQGQLTAY 1 mg ≥ 95% EP11143_1 100 EUR Add to cart


Antigen Peptide EBV BZLF1 HLA-B*3501 (EPLPQGQLTAY) for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. EPLPQGQLTAY is a linear peptidic epitope (epitope ID13701) studied as part of Trans-activator protein BZLF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity tested in T cell assays and MHC ligand assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BZLF-1 54-64 (HLA-B*35:01) EPLPQGQLTAY 5 mg ≥ 95% EP11143_5 170 EUR Add to cart


Antigen Peptide EBV BZLF1 HLA-B*3501 (EPLPQGQLTAY) for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. EPLPQGQLTAY is a linear peptidic epitope (epitope ID13701) studied as part of Trans-activator protein BZLF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity tested in T cell assays and MHC ligand assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV BZLF-1 54-64 mutant (HLA-B*35:01) EPLSQSQITAY 1 mg ≥ 95% EP11144_1 100 EUR Add to cart


sterile and endotoxin free

EBV BZLF-1 54-64 mutant (HLA-B*35:01) EPLSQSQITAY 5 mg ≥ 95% EP11144_5 170 EUR Add to cart


sterile and endotoxin free

EBV BZLF1 44-52 (HLA-B*07:02) LPCVLWPVL 1 mg ≥95% EP11214_1 50 EUR Add to cart


LPCVLWPVL is a linear peptidic epitope studied as part of Trans-activator protein BZLF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free




EBV BZLF1 44-52 (HLA-B*07:02) LPCVLWPVL 5 mg ≥95% EP11214_5 100 EUR Add to cart


LPCVLWPVL is a linear peptidic epitope studied as part of Trans-activator protein BZLF1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA 3A 246–253 (HLA-A*24:02) RYSIFFDY 1 mg ≥ 95% EP11147_1 50 EUR Add to cart


RYSIFFDY is a linear peptidic epitope (epitope ID 56650) studied as part of Epstein-Barr nuclear antigen 3 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA 3A 246–253 (HLA-A*24:02) RYSIFFDY 5 mg ≥ 95% EP11147_5 100 EUR Add to cart


RYSIFFDY is a linear peptidic epitope (epitope ID 56650) studied as part of Epstein-Barr nuclear antigen 3 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA 3B 399-408 (HLA-A*11:01) AVFDRKSDAK 1 mg ≥ 95% EP11150_1 50 EUR Add to cart


Antigen Peptide EBV EBNA3B 399-408 (HLA-A*11:01) AVFDRKSDAK for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA 3B 399-408 (HLA-A*11:01) AVFDRKSDAK 5 mg ≥ 95% EP11150_5 100 EUR Add to cart


Antigen Peptide EBV EBNA3B 399-408 (HLA-A*11:01) AVFDRKSDAK for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA 3C 258-266 (HLA-B*27:02)(HLA-B*27:05)(HLA-B*27:04) RRIYDLIEL 1 mg ≥ 95% EP11481_1 50 EUR Add to cart


RRIYDLIEL is a linear peptidic epitope (epitope ID55620) studied as part of Epstein-Barr nuclear antigen 6 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA 3C 258-266 (HLA-B*27:02)(HLA-B*27:05)(HLA-B*27:04) RRIYDLIEL 5 mg ≥ 95% EP11481_5 100 EUR Add to cart


RRIYDLIEL is a linear peptidic epitope (epitope ID55620) studied as part of Epstein-Barr nuclear antigen 6 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-1 407-417 (HLA-B*35:01) HPVGEADYFEY 1 mg ≥ 95% EP08274_1 50 EUR Add to cart


Antigen Peptide EBV EBNA-1 407-417 (HLA-B*35:01) HPVGEADYFEY for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. ngle peptide (HPVGEADYFEY) for stimulation of human EBV EBNA-1-specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*3501 allele. HPVGEADYFEY is a linear peptidic epitope (epitope ID24536) studied as part of Epstein-Barr nuclear antigen 1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-1 407-417 (HLA-B*35:01) HPVGEADYFEY 5 mg ≥ 95% EP08274_5 100 EUR Add to cart


Antigen Peptide EBV EBNA-1 407-417 (HLA-B*35:01) HPVGEADYFEY for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays. ngle peptide (HPVGEADYFEY) for stimulation of human EBV EBNA-1-specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*3501 allele. HPVGEADYFEY is a linear peptidic epitope (epitope ID24536) studied as part of Epstein-Barr nuclear antigen 1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-1 407-417 mutant (HLA-B*35:01) 410A HPVAEADYFEY 1 mg ≥ 95% EP11145_1 80 EUR Add to cart


EBNA1-derived peptide of HPVAEADYFEY covering 407-417 and B*35:08 molecule. HPVAEADYFEY is a linear peptidic epitope (epitope ID 227777) studied as part of Epstein-Barr nuclear antigen 1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-1 407-417 mutant (HLA-B*35:01) 410A HPVAEADYFEY 5 mg ≥ 95% EP11145_5 150 EUR Add to cart


EBNA1-derived peptide of HPVAEADYFEY covering 407-417 and B*35:08 molecule. HPVAEADYFEY is a linear peptidic epitope (epitope ID 227777) studied as part of Epstein-Barr nuclear antigen 1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-1 407-417 mutant (HLA-B*35:01) 411D HPVGDADYFEY 1 mg ≥ 95% EP11146_1 80 EUR Add to cart


EBV EBNA1-derived peptide of HPVGDADYFEY covering 407-417 and B*35:08 molecule. HPVGDADYFEY is a linear peptidic epitope (epitope ID 24525) studied as part of Epstein-Barr nuclear antigen 1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-1 407-417 mutant (HLA-B*35:01) 411D HPVGDADYFEY 5 mg ≥ 95% EP11146_5 150 EUR Add to cart


EBV EBNA1-derived peptide of HPVGDADYFEY covering 407-417 and B*35:08 molecule. HPVGDADYFEY is a linear peptidic epitope (epitope ID 24525) studied as part of Epstein-Barr nuclear antigen 1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-1 72–80 (HLA-B*35:01) RPQKRPSCI 1 mg ≥95% EP14015_1 50 EUR Add to cart


RPQKRPSCI is a linear peptidic epitope studied as part of Epstein-Barr nuclear antigen 1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-1 72–80 (HLA-B*35:01) RPQKRPSCI 5 mg ≥95% EP14015_5 100 EUR Add to cart


RPQKRPSCI is a linear peptidic epitope studied as part of Epstein-Barr nuclear antigen 1 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-3A 325-333 (HLA-B*08:01) FLRGRAYGL 1 mg ≥ 95% EP06163_1 50 EUR Add to cart


Antigen Peptide EBV EBNA3A HLA-B*0801 (FLRGRAYGL) for stimulation of human EBV EBNA-3A(325-333) -specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*0801 allele.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-3A 325-333 (HLA-B*08:01) FLRGRAYGL 5 mg ≥ 95% EP06163_5 100 EUR Add to cart


Antigen Peptide EBV EBNA3A HLA-B*0801 (FLRGRAYGL) for stimulation of human EBV EBNA-3A(325-333) -specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*0801 allele.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-3A 379-387 (HLA-B*07:02) RPPIFIRRL 1 mg ≥ 95% EP05817_1 50 EUR Add to cart


Antigen Peptide EBV EBNA3A HLA-B*0702 (RPPIFIRRL) for stimulation of human EBV EBNA-3A (379-387) specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*0702 allele.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-3A 379-387 (HLA-B*07:02) RPPIFIRRL 5 mg ≥ 95% EP05817_5 100 EUR Add to cart


Antigen Peptide EBV EBNA3A HLA-B*0702 (RPPIFIRRL) for stimulation of human EBV EBNA-3A (379-387) specific CD8+ T-cells. The peptide is synthesised as it is presented by the MHC class I HLA-B*0702 allele.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-3A 458-466 (HLA-B*35:01) YPLHEQHGM 1 mg ≥ 95% EP11148_1 50 EUR Add to cart


HLA-B35-restricted epitope from Epstein-Barr Virus latent nuclear antigen 3A (458-466) for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-3A 458-466 (HLA-B*35:01) YPLHEQHGM 5 mg ≥ 95% EP11148_5 100 EUR Add to cart


HLA-B35-restricted epitope from Epstein-Barr Virus latent nuclear antigen 3A (458-466) for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-3A 603-611 (HLA-A*03:01) RLRAEAQVK 1 mg ≥ 95% EP07892_1 50 EUR Add to cart


RLRAEAQVK is a linear peptidic epitope (epitope ID54728) studied as part of Epstein-Barr nuclear antigen 3 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-3A 603-611 (HLA-A*03:01) RLRAEAQVK 5 mg ≥ 95% EP07892_5 100 EUR Add to cart


RLRAEAQVK is a linear peptidic epitope (epitope ID54728) studied as part of Epstein-Barr nuclear antigen 3 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-3C 284-293 (HLA-A*02:01) LLDFVRFMGV 1 mg ≥ 95% EP11149_1 50 EUR Add to cart


LLDFVRFMGV is a linear peptidic epitope (epitope ID 37153) studied as part of Epstein-Barr nuclear antigen 6 from Human herpesvirus 4 (Epstein Barr virus) and Other Human herpesvirus 4 (Epstein Barr virus) protein from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-3C 284-293 (HLA-A*02:01) LLDFVRFMGV 5 mg ≥ 95% EP11149_5 100 EUR Add to cart


LLDFVRFMGV is a linear peptidic epitope (epitope ID 37153) studied as part of Epstein-Barr nuclear antigen 6 from Human herpesvirus 4 (Epstein Barr virus) and Other Human herpesvirus 4 (Epstein Barr virus) protein from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-3C 881-889 (HLA-B*07:02) QPRAPIRPI 1 mg ≥ 95% EP11152_1 50 EUR Add to cart


QPRAPIRPI is a linear peptidic epitope (epitope ID 51946) studied as part of Epstein-Barr nuclear antigen 6 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA-3C 881-889 (HLA-B*07:02) QPRAPIRPI 5 mg ≥ 95% EP11152_5 100 EUR Add to cart


QPRAPIRPI is a linear peptidic epitope (epitope ID 51946) studied as part of Epstein-Barr nuclear antigen 6 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA3A 158-166 (HLA-B*08:01) QAKWRLQTL 1 mg ≥ 95% EP11153_1 50 EUR Add to cart


QAKWRLQTL is a linear peptidic epitope (epitope ID50298) studied as part of Epstein-Barr nuclear antigen 3 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA3A 158-166 (HLA-B*08:01) QAKWRLQTL 5 mg ≥ 95% EP11153_5 100 EUR Add to cart


QAKWRLQTL is a linear peptidic epitope (epitope ID50298) studied as part of Epstein-Barr nuclear antigen 3 from Human herpesvirus 4 (Epstein Barr virus). This epitope has been studied for immune reactivity, tested in T cell assays and MHC ligand assays

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA3B 416-424 (HLA-A*11:01; HLA-A*68:01) IVTDFSVIK 1 mg ≥ 95% EP11151_1 50 EUR Add to cart


Antigen Peptide EBV EBNA3B 416-424 (HLA-A*11:01; ; HLA-A*6801) IVTDFSVIK for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA3B 416-424 (HLA-A*11:01; HLA-A*68:01) IVTDFSVIK 5 mg ≥ 95% EP11151_5 100 EUR Add to cart


Antigen Peptide EBV EBNA3B 416-424 (HLA-A*11:01; ; HLA-A*6801) IVTDFSVIK for stimulation of antigen-specific T cells in T cell assays such as ELISPOT, ICS, cytotoxity or proliferation assays.

Delivery Format: The product is supplied freeze dried as trifluoracetate salt

sterile and endotoxin free

EBV EBNA3C 281 – 290 (HLA-B*44:05) EENLLDFVRF 1 mg ≥ 95% EP11483_1 50 EUR