LL - 37, scrambled
Anti-microbial Peptide Human Host Defense Peptide
Sequence: | GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR | |
Delivery: | 3 weeks | |
C-Terminus: | OH | |
N-Terminus: | H | |
Amount: | 1 mg | |
Counter Ion: | TFA | |
Allele: | ||
Purity : | 95% HPLC-MS |
Protocols and Tips
Data sheets
Safety data sheet poly peptides:
Special references for this product will come soon.
For your convenience, we have compiled a selection of publications
where our peptide products have been employed:
Publications >
For your convenience, we have compiled a selection of publications
where our peptide products have been employed:
Publications >
€211.35*
Delivery time 2-3 days
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.
Purity: 95% HPLC-MS
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.
Purity: 95% HPLC-MS
Product number:
EP11652_1