Structure of LL - 37
Logo for Infectious disease
Infectious disease

LL - 37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Product number: EP11651_5

€570.50*

Prices excl. VAT plus shipping costs
Available, delivery time: 3 weeks
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.
Purity: 95% HPLC-MS
Caution: For research use only. Not for use in humans.
Amount in mg
1
Add to Cart

Description

The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). Antimicrobial peptide LL-37,ï¾  belongsï¾  to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human.ï¾  It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds.ï¾  Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution.

TechData

Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Delivery: 3 weeks
C-Terminus: OH
N-Terminus: H
Amount: 1 mg
Counterion: TFA
Indication: Infectious disease
Purity: 95% HPLC-MS