[beta]-Amyloid (1-39)
€345.00 *
Prices plus VAT plus shipping costs
Delivery time 3 weeks
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.
- Order number: EP10043_1
A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and... more
Product information "[beta]-Amyloid (1-39)"
A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and 1-43), are identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease. The length of the C-terminus is a critical determinant of the rate of amyloid formation (“kinetic solubility”), with only a minor effect on the thermodynamic solubility. Amyloid formation by the kinetically soluble peptides (e.g. 1-39) can be nucleated, or “seeded” by peptides which include the critical C-terminal residues (1-42, 26-42, 26-43, 34-42).
Available downloads:
####
Sequence: | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV | |
Gene: | APP | |
Delivery: | 3 weeks | |
C-Terminus: | OH | |
N-Terminus: | H | |
Purity: | 95% | |
Amount: | 1 mg | |
Counter Ion: | TFA | |
Protein: | Amyloid-beta precursor protein | |
Species: | Human | |
Application : | Neuroscience | |
Indication : | Alzheimer's Disease |
Dokumente - Protokolle - Downloads more
Protocols and Tips
Data sheets
Viewed