[beta]-Amyloid (1-39)
A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and 1-43), are identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease. The length of the C-terminus is a critical determinant of the rate of amyloid formation (“kinetic solubility”), with only a minor effect on the thermodynamic solubility. Amyloid formation by the kinetically soluble peptides (e.g. 1-39) can be nucleated, or “seeded” by peptides which include the critical C-terminal residues (1-42, 26-42, 26-43, 34-42).
Sequence: | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV | |
Gene: | APP | |
Delivery: | 3 weeks | |
C-Terminus: | OH | |
N-Terminus: | H | |
Amount: | 1 mg | |
Counter Ion: | TFA | |
Protein: | Amyloid-beta precursor protein | |
Species: | Human | |
Allele: | ||
Application : | Neuroscience | |
Indication : | Alzheimer's Disease | |
Purity : | 95% HPLC-MS |
Protocols and Tips
Data sheets
Safety data sheet poly peptides:
Special references for this product will come soon.
For your convenience, we have compiled a selection of publications
where our peptide products have been employed:
Publications >
For your convenience, we have compiled a selection of publications
where our peptide products have been employed:
Publications >
€380.50*
Available, delivery time: 3-4 weeks
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.
Purity: 95% HPLC-MS
Product number:
EP10043_1