[beta]-Amyloid (1-40)

[beta]-Amyloid (1-40)
€345.00 *

Prices plus VAT plus shipping costs

Delivery time 2-3 days
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.

Amount in mg:

5 mg

  • Order number: EP10059_1
Description Technical data Documents Accessories
Description
A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and... more
Close menu
Product information "[beta]-Amyloid (1-40)"

A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and 1-43), are identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease. The length of the C-terminus is a critical determinant of the rate of amyloid formation (“kinetic solubility”), with only a minor effect on the thermodynamic solubility. Amyloid formation by the kinetically soluble peptides (e.g. 1-40) can be nucleated, or “seeded” by peptides which include the critical C-terminal residues (1-42, 26-42, 26-43, 34-42).

Available downloads:
more

Zurück
 
Sequence:DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Gene:APP
Delivery: 2-3 days
C-Terminus:OH
N-Terminus:H
Purity:95%
Amount:1 mg
Counter Ion:TFA
Protein:Amyloid-beta precursor protein
Species:Rat
Application :Neuroscience
Indication :Alzheimer's Disease
####
    Dokumente - Protokolle - Downloads more
    Zurück

    Protocols and Tips

    Data sheets

     
    Accessories 0
    Customers also bought Customers also viewed
    Customers also bought
    Customers also viewed
    HEL 11-25
    From €115.00 *
    EBV LMP-2 340-349 mutant (HLA-A*11:01) 348T
    From €57.50 *
    Mesothelin 429-437 (HLA-A*01:01)
    From €57.50 *
    Mena protein (overexpressed in breast cancer)...
    From €57.50 *
    EBNA 3a (596-604)
    From €57.50 *
    HM1.24 126-134 (HLA-A*02:01)
    From €57.50 *
    EBV BMLF-1 280-288 (HLA-A*02:01)
    From €57.50 *
    OVA - T4 , SIITFEKL, pT4, OVA (257 - 264)...
    From €57.50 *
    HCoV-OC43 (Spike Glycoprotein) Peptide Pool HCoV-OC43 (Spike Glycoprotein) Peptide Pool
    €517.50 *
    HHV6 (U90) Peptide Pool HHV6 (U90) Peptide Pool
    €258.75 *
    SARS-CoV-2 Surface GP A2 1000-1008 (HLA-A*02:01)
    From €92.00 *
    SARS-CoV-2 ORF3a prot_1 A2 (HLA-A*02:01)
    From €92.00 *
    SARS-CoV Nucleocapsid A2 316-324 (HLA-A*02:01)
    From €92.00 *
    HPV E6 133–142
    From €57.50 *
    STREP-tag II
    From €57.50 *
    NS4b 77-91
    From €115.00 *
    RSV Fusion protein 191-199 (HLA-A*02:01)
    From €57.50 *
    PSMA 178-186 (HLA-A*24:02)
    From €57.50 *
    Influenza A virus (A/Puerto Rico/8/1934(H1N1))...
    From €57.50 *
    WT1 235–243 mutant (HLA-A*24:02) 236Y
    From €57.50 *
    Plasmodium falciparum CSP 334-342 (HLA-A*02:01)
    From €57.50 *
    PASD1 694-702 (HLA-A*02:01)
    From €57.50 *
    Mesothelin 20-28 (HLA-A*02:01)
    From €57.50 *
    MAGE-A3 112-120 (HLA-A*02:01)
    From €57.50 *
    MAGE-A1 289-298 (HLA-B*07:02)
    From €57.50 *
    MAGEA-10 254-262 (HLA-A*02:01)
    From €57.50 *
    KIF20A 67-75 (HLA-A*24:02)
    From €57.50 *
    Influenza A PB1 591-599 (HLA-A*01:01)
    From €57.50 *
    Influenza A MP2 70-78 (HLA-A*11:01)
    From €57.50 *
    IL13Ra 345-353 (HLA-A*02:01)
    From €57.50 *
    IGRP 265–273 (HLA-A*02:01)
    From €57.50 *
    IA-2 797-805 (HLA-A*02:01)
    From €57.50 *
    HSP105 180-188 (HLA-A*24:02)
    From €57.50 *
    HPV16 E7 82-92 (HLA-A*02:01)
    From €57.50 *
    hMena 502-510 (HLA-A*02:01)
    From €57.50 *
    EBV BZLF1 44-52 (HLA-B*07:02)
    From €57.50 *
    EBV BRLF1 101-109 (HLA-A*29:02)
    From €57.50 *
    ABL1 (HLA-A*02:01)
    From €57.50 *
    PRAME 425-433 (HLA-A*02:01)
    From €57.50 *
    HCMVlfl
    From €57.50 *
    Viewed
    This website uses cookies to ensure you get the best experience on our website.
    Accept
    [beta]-Amyloid (1-40)