usps-logo.jpg?1721728722
Ultrafast Ultrasonic Synthesis
Catalog peptides: immediate delivery
ISO 9001/2015 certified
1000 peptides & peptide pools
30 years of experience in peptide synthesis

[beta]-Amyloid (1-40)



A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and 1-43), are identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease. The length of the C-terminus is a critical determinant of the rate of amyloid formation (“kinetic solubility”), with only a minor effect on the thermodynamic solubility. Amyloid formation by the kinetically soluble peptides (e.g. 1-40) can be nucleated, or “seeded” by peptides which include the critical C-terminal residues (1-42, 26-42, 26-43, 34-42).

Sequence:DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Gene:APP
Delivery: 2-3 days
C-Terminus:OH
N-Terminus:H
Amount:1 mg
Counter Ion:TFA
Protein:Amyloid-beta precursor protein
Species:Rat
Allele:
Application :Neuroscience
Indication :Alzheimer's Disease
Purity :95% HPLC-MS
Special references for this product will come soon.
For your convenience, we have compiled a selection of publications
where our peptide products have been employed:
Publications >

€380.50*

Delivery time 2-3 days
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.
Purity: 95% HPLC-MS
Amount in mg
Product number: EP10059_1