Structure of [beta]-Amyloid (1-39)
Logo for Neuroscience
Neuroscience

[beta]-Amyloid (1-39) DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV

Product number: EP10043_5

€466.20*

Prices excl. VAT plus shipping costs
Available, delivery time: 3 weeks
sterile and endotoxin free
Delivery Format: The product is supplied freeze dried.
Purity: 95% HPLC-MS
Caution: For research use only. Not for use in humans.
Amount in mg
1
Add to Cart

Description

A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and 1-43), are identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease. The length of the C-terminus is a critical determinant of the rate of amyloid formation (“kinetic solubility”), with only a minor effect on the thermodynamic solubility. Amyloid formation by the kinetically soluble peptides (e.g. 1-39) can be nucleated, or “seeded” by peptides which include the critical C-terminal residues (1-42, 26-42, 26-43, 34-42).

TechData

Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Gene: APP
Delivery: 3 weeks
C-Terminus: OH
N-Terminus: H
Amount: 5 mg
Counterion: TFA
Protein: Amyloid-beta precursor protein
UniProt Id: P05067
Species: Human
Application: ELISPOT, Flow Cytometry, Western Blotting
Indication: Neuroscience
Purity: 95% HPLC-MS